KEGG   Listeria monocytogenes HCC23 (serotype 4a): LMHCC_0932Help
Entry
LMHCC_0932        CDS       T00801                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
lmh  Listeria monocytogenes HCC23 (serotype 4a)
Pathway
lmh00400  Phenylalanine, tyrosine and tryptophan biosynthesis
lmh01100  Metabolic pathways
lmh01110  Biosynthesis of secondary metabolites
lmh01130  Biosynthesis of antibiotics
lmh01230  Biosynthesis of amino acids
Module
lmh_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:lmh00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    LMHCC_0932 (trpC)
Enzymes [BR:lmh01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     LMHCC_0932 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS
Motif
Other DBs
NCBI-ProteinID: ACK39281
UniProt: B8DHB2
Position
963574..964332
Genome map
AA seq 252 aa AA seqDB search
MTFLEEILAQKAVEVADMPLEKVAEKRKTYSFYEFLKANTNTMQLIAEVKRASPSKGEIN
MGVNPVLQAKSYQAAGAGMISVLTDPVFFKGSIEDLREVAKNVEIPVLCKDFIISEKQLI
RARNAGATVVLLIISALTEEMLITLFEQALALDLEVLVEVHDQKELAVAQKIGAKLIGVN
NRNLHTFEVDIAVSERLASDFSSDACFISESGFRTAEDVARVSQKYNAVLVGEALMREAT
PEAAAKSLKVTR
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgacatttttagaagaaattttagcgcaaaaagcagtagaagttgcagacatgccctta
gaaaaagtagccgaaaaacggaaaacttattcgttttatgaatttttaaaagcaaatacc
aacacgatgcaacttattgcagaagtaaaacgcgcctctccttctaaaggggaaatcaat
atgggcgtgaatccggttctgcaagccaagtcttatcaagctgcgggtgcaggaatgatt
tctgttttgacagatcctgtttttttcaaaggctcgattgaagatttgcgagaagtagcg
aaaaatgtcgaaattcctgtactatgtaaagattttattattagtgaaaaacaattgatt
cgtgctcgaaatgcgggagcaacggttgtattgctaattatttctgcacttacagaagag
atgctaattaccctgtttgaacaagctctggcgcttgatttggaagtgttagtggaagta
catgaccagaaagaattagctgttgctcaaaaaattggagctaaactcattggtgtgaac
aaccgtaatttgcatacatttgaagtggatattgcagtaagtgaaagactggcgagcgat
ttctcgtcggatgcttgtttcataagtgaatcaggttttcgaacagctgaagatgtggct
cgggttagtcaaaaatataatgcagtacttgttggagaagcgctaatgcgagaagcgact
ccagaagcagcggcgaaaagtttgaaggtgacacgatga

DBGET integrated database retrieval system