KEGG   Listeria monocytogenes HCC23 (serotype 4a): LMHCC_0934Help
Entry
LMHCC_0934        CDS       T00801                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
lmh  Listeria monocytogenes HCC23 (serotype 4a)
Pathway
lmh00260  Glycine, serine and threonine metabolism
lmh00400  Phenylalanine, tyrosine and tryptophan biosynthesis
lmh01100  Metabolic pathways
lmh01110  Biosynthesis of secondary metabolites
lmh01130  Biosynthesis of antibiotics
lmh01230  Biosynthesis of amino acids
Module
lmh_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:lmh00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LMHCC_0934 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    LMHCC_0934 (trpB)
Enzymes [BR:lmh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     LMHCC_0934 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ACK39283
UniProt: B8DHB4
Position
964940..966142
Genome map
AA seq 400 aa AA seqDB search
MTYQAPDENGFYGKFGGRFVPETLMKAVKELDEAYRASKTDPAFQKELNYYLKEYVGRET
PLYFAEQLTAHAGGAKIYLKREDLNHTGAHKINNTIGQALLARQMGKQKVVAETGAGQHG
VATATVAALFNMECTIFMGEEDVKRQSLNVFRMELLGAKVVSVKAGSRTLKDAVNEALRF
WVANVEDTHYIMGSVLGPHPFPEIVRDYQSVIGIEARKQHLEKEGKLPDAIVACVGGGSN
AMGLFYPFVDDVSVQMHGVEAAGHGLETEFHAATISKGEIGILHGAMMDVLQDENGQILE
AFSISAGLDYPGIGPEHSFFRDLGRAAYHSVTDDEAVEAFQLLCRTEGIIPALESSHAIS
YAVKLASQMRPEESMVVCLSGRGDKDVNQLKERLEGQTND
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgacttatcaagcacctgacgaaaatggcttttacggaaaatttggcggcagatttgta
ccagaaacattaatgaaagcagtgaaagaattagatgaggcgtaccgagcttccaaaaca
gatcctgcttttcaaaaagaattaaactattatttaaaagaatatgtgggccgagaaaca
ccactttattttgctgaacaattaacagcacatgcgggcggagcaaaaatttatttaaaa
cgcgaagatttaaatcatactggcgcgcataaaatcaataatactattgggcaagcttta
ctcgcacgtcaaatgggcaaacaaaaagtagtggcagaaactggcgcaggacaacacgga
gtggcgactgcaactgttgcagcactttttaatatggaatgtactatttttatgggagaa
gaagatgtgaaacgccaatcactcaatgtgtttagaatggaacttcttggtgcaaaagta
gtaagcgtgaaagcaggaagcagaacattaaaagacgcagtaaatgaggcgctcagattc
tgggttgctaatgtggaagatacacattatattatgggatccgttcttggaccgcatcca
tttccagaaattgttcgtgattaccaaagtgttattggaatagaagccagaaaacagcat
ttggaaaaagaaggcaaacttcctgacgcaattgtcgcttgtgtaggtggtggtagcaat
gcgatgggcttgttttatccattcgtagacgatgtttctgttcaaatgcacggggtagaa
gcagcggggcacggtttagaaactgaattccatgcagcaactatttccaaaggagaaatc
gggattttacacggagcgatgatggatgttttacaagatgagaatgggcaaattttagaa
gcattttcgatttcagcaggcttagattatccaggtattggtccggagcatagctttttc
cgtgatttaggtcgtgcagcgtaccattctgttaccgatgatgaagccgttgaagcattt
caacttttatgtcgtacagaaggaatcattcctgcacttgaaagctcgcacgcgattagt
tatgcagtcaaacttgcaagccagatgcgtccagaagaaagtatggtcgtttgcttatct
ggtcgcggagataaagatgttaaccaactaaaggaacgcttggagggacaaacaaatgac
taa

DBGET integrated database retrieval system