KEGG   Listeria monocytogenes HCC23 (serotype 4a): LMHCC_1154Help
Entry
LMHCC_1154        CDS       T00801                                 

Definition
(GenBank) acetyl-CoA acetyltransferase (Acetoacetyl-CoA thiolase)
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
lmh  Listeria monocytogenes HCC23 (serotype 4a)
Pathway
lmh00071  Fatty acid degradation
lmh00072  Synthesis and degradation of ketone bodies
lmh00280  Valine, leucine and isoleucine degradation
lmh00310  Lysine degradation
lmh00362  Benzoate degradation
lmh00380  Tryptophan metabolism
lmh00620  Pyruvate metabolism
lmh00630  Glyoxylate and dicarboxylate metabolism
lmh00640  Propanoate metabolism
lmh00650  Butanoate metabolism
lmh00900  Terpenoid backbone biosynthesis
lmh01100  Metabolic pathways
lmh01110  Biosynthesis of secondary metabolites
lmh01120  Microbial metabolism in diverse environments
lmh01130  Biosynthesis of antibiotics
lmh01200  Carbon metabolism
lmh01212  Fatty acid metabolism
lmh02020  Two-component system
Brite
KEGG Orthology (KO) [BR:lmh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    LMHCC_1154
   00630 Glyoxylate and dicarboxylate metabolism
    LMHCC_1154
   00640 Propanoate metabolism
    LMHCC_1154
   00650 Butanoate metabolism
    LMHCC_1154
  09103 Lipid metabolism
   00071 Fatty acid degradation
    LMHCC_1154
   00072 Synthesis and degradation of ketone bodies
    LMHCC_1154
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LMHCC_1154
   00310 Lysine degradation
    LMHCC_1154
   00380 Tryptophan metabolism
    LMHCC_1154
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LMHCC_1154
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LMHCC_1154
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    LMHCC_1154
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lmh04147]
    LMHCC_1154
Enzymes [BR:lmh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     LMHCC_1154
Exosome [BR:lmh04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LMHCC_1154
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: ACK39502
Position
1193694..1194863
Genome map
AA seq 389 aa AA seqDB search
MNEVVIIDAVRTPIGKFGGSLKDISAVELGATALKGVLERANIAPDRVDQVIFGNVLQAG
LGQNVARQVAIKAGIPYKVPGVTINEVCGSGLKSIMLGRQAIQLGEADIVAVGGTENMSQ
APLLLNPELAGEEIDPKNLRNSMLIDGLTDVYGDYHMGITAENVAEKFSVTREEQDKFAH
NSQMKAASAQEKNLFEEEIIPVKLADGSFFEADETIRANSTLEKLATLKSVFKEDGTVTA
GNASGINDGASALILMSKEKAIAENIPFIATIKVTSEVGVDPAYMGYAPYYAVNEALTKG
GYSIDDIDLFHLNEAFASQSVAVARDLKIPEDKLNIYGGAIALGHPIGASGARIIASLLN
ELKHENKHLGVASLCIGGGIGIAIIVERA
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaagtagttataatagatgcagttagaacaccaattggaaaattcggtggcagt
ttgaaagacatcagtgcagtagaacttggcgctaccgctctaaaaggcgtattagaaaga
gccaacattgctccagaccgcgtagatcaagttatttttggtaacgttttacaagcaggt
ctcggtcaaaacgtagctagacaagtcgctattaaagcaggaattccttataaagtacct
ggagtcacaatcaatgaagtttgtggatctggtttaaaatcgattatgcttggaagacaa
gcgatccaattaggcgaggccgacattgtagcagtgggagggaccgaaaacatgtctcaa
gcaccactattacttaatccggaactagccggcgaagaaattgatcccaaaaacttaaga
aatagcatgttaattgatggtttaacggatgtgtacggcgattatcatatgggaattaca
gccgaaaatgtggcagaaaaattctctgtaacccgagaagagcaagataaatttgcacat
aactcccaaatgaaagcagcaagtgcacaagaaaaaaacctttttgaagaagaaattatt
ccagtgaaacttgcagatggttcgtttttcgaagccgatgaaacgattcgtgcgaattcc
actttagaaaaactagctacattaaaaagcgtatttaaagaagatggaacagtcacagct
ggtaatgcttccgggatcaatgacggagcttctgcgcttattttaatgtcgaaggaaaag
gccattgccgaaaatattccttttatcgcgacaatcaaagtaacttcagaagttggtgtt
gatccagcatatatgggttacgcgccttactatgcagtaaatgaagcattaactaaaggc
ggatattctatcgatgacattgatctatttcatttaaatgaagcttttgcatcacagtcg
gttgccgtagctcgtgatttgaaaattccagaagataaactgaatatttacggcggagca
attgcgttaggtcatccaatcggagcatccggagcacgcattattgcctccttattaaat
gagttaaaacacgaaaataaacatcttggcgtggcttccttatgtatcggcggcggtatt
ggaattgcaattattgtcgaaagagcttga

DBGET integrated database retrieval system