KEGG   Listeria monocytogenes HCC23 (serotype 4a): LMHCC_1240Help
Entry
LMHCC_1240        CDS       T00801                                 

Gene name
rpsO
Definition
(GenBank) ribosomal protein S15
  KO
K02956  small subunit ribosomal protein S15
Organism
lmh  Listeria monocytogenes HCC23 (serotype 4a)
Pathway
lmh03010  Ribosome
Module
lmh_M00178  Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:lmh00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    LMHCC_1240 (rpsO)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:lmh03011]
    LMHCC_1240 (rpsO)
Ribosome [BR:lmh03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Small subunit
    LMHCC_1240 (rpsO)
  Bacteria
    LMHCC_1240 (rpsO)
  Archaea
    LMHCC_1240 (rpsO)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_S15
Motif
Other DBs
NCBI-ProteinID: ACK39587
UniProt: B8DFZ7
Position
complement(1281054..1281323)
Genome map
AA seq 89 aa AA seqDB search
MALTQERKNEIIAEYRVHDTDTGSPEVQIAVLTAEINSLNEHVRVHKKDHHSYRGLMKMV
GHRRNLLTYLRKKDVQRYRELIKRLGLRR
NT seq 270 nt NT seq  +upstreamnt  +downstreamnt
atggctttaactcaagaacgcaaaaatgaaattattgcagagtaccgtgtccatgataca
gatactggttcaccagaagtacaaatcgctgtattaactgctgaaatcaatagcttaaat
gaacacgttcgcgtacacaaaaaagatcatcactcttaccgtggattaatgaaaatggta
ggtcaccgtcgtaacctattaacttacctacgtaaaaaagatgttcaacgttaccgcgaa
cttatcaaacgtttaggtttacgtcgataa

DBGET integrated database retrieval system