KEGG   Listeria monocytogenes HCC23 (serotype 4a): LMHCC_1443Help
Entry
LMHCC_1443        CDS       T00801                                 

Gene name
cbiP
Definition
(GenBank) cobyric acid synthase CbiP
  KO
K02232  adenosylcobyric acid synthase [EC:6.3.5.10]
Organism
lmh  Listeria monocytogenes HCC23 (serotype 4a)
Pathway
lmh00860  Porphyrin and chlorophyll metabolism
lmh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lmh00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    LMHCC_1443 (cbiP)
Enzymes [BR:lmh01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.10  adenosylcobyric acid synthase (glutamine-hydrolysing)
     LMHCC_1443 (cbiP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3 AAA_26 CbiA MobB DJ-1_PfpI GATase GATase_5 AbiH GETHR
Motif
Other DBs
NCBI-ProteinID: ACK39788
UniProt: B8D9Y4
Position
complement(1464762..1466297)
Genome map
AA seq 511 aa AA seqDB search
MVKQIMIQGTASDAGKSVLVAGLCRLFKNKGKQVVPFKSQNMSLNSFITVTGDEMGRAQV
FQAEAAGVFPDVRMNPVLLKPTNDRQSQVIFMGAILDNMDAVTYHDFKQTLIPKIQAVYQ
SLADENDIIVLEGAGSPAEINLNDRDIVNMGMAKMVDAPVVLVADIDKGGVFASIYGTIM
LLNEEERARIKGVIINKFRGDVALLQPGIDMIEELTNVPVIGVIPYANLQLEEEDSVSLS
GKNYAPDSNALLDIAIICLPRISNFTDFHSLEIQPEISLRYIRNLADFGKPDLVIIPGSK
NTLEDMAFLEESGLKKAIQNFAENAGKVIGICGGYQMLGQKMLDPNQVESRQLEIAGLGL
LDTETIFLEQKRTTQITGVTHSGEAVEGYEIHMGETKRGESTSPFCKIKAVNGNEETHQD
GAISANKNIIGTYIHGIFDNDVFLGNLFDELLTRKNQSIYPHEIINLKEHKEQEYDKLAA
LLEANIQMDQLEKIMKGEKICVSTQKPAIKE
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atggtaaagcaaataatgattcaaggtaccgcttctgatgccgggaaaagtgtactggtt
gcaggcctatgccgcctattcaaaaataaaggcaagcaagttgttccgtttaaatcacaa
aatatgtccctcaattcttttataacagtaaccggagatgaaatgggacgcgcgcaagtt
tttcaagcagaagcggctggcgtctttccggatgtccggatgaatcccgtgttacttaaa
ccgaccaatgacaggcagtcgcaagtgatttttatgggtgcaattttagataatatggat
gctgtgacgtaccacgatttcaaacaaacccttatcccgaaaatccaggcagtttaccag
agtttagccgatgaaaatgatattattgtactagaaggtgctggaagcccagcagaaatc
aacttaaatgaccgagatatcgtgaatatgggtatggcaaaaatggtcgatgccccagtt
gtcttagttgctgatattgacaaaggtggcgtttttgcttcgatatacggcaccattatg
ctgttaaatgaagaagagcgggctcgaatcaaaggtgtgattatcaataaattccgcggc
gatgtagctcttttacaacccggaattgatatgattgaggaactcacaaacgtcccggtt
atcggtgtgattccctatgccaatctacaactggaagaagaggacagtgtttctctaagt
gggaaaaattacgcgccagatagtaatgcactgcttgatatcgcgattatttgtttacca
cgtatttcgaactttacagactttcatagtttggaaatccaaccggaaataagtttgcgc
tacatacgaaatctagctgattttggaaaacctgatttagtcatcattccaggcagtaaa
aatacgctagaagacatggcatttctcgaagaatcaggactgaaaaaagctattcaaaat
tttgcggagaatgccggaaaagtaatcgggatttgtggtggctaccaaatgctcggtcaa
aaaatgctcgatccgaatcaagtggagagtagacaactagaaatagccggacttggtttg
ctagataccgagaccatttttctcgagcaaaagcgcactactcaaattacaggtgtgacg
cattcaggagaagctgttgaagggtacgaaatccatatgggtgagacgaagcgcggcgag
agcactagtccattttgtaaaattaaagcggtgaacggaaacgaagaaacccaccaagat
ggcgctatctctgccaacaaaaatatcatcggcacctatattcatggtattttcgacaat
gatgttttcttgggaaatctatttgacgaactactaacgcgcaaaaaccaatccatttat
ccgcatgaaatcattaatctgaaagaacacaaagaacaagaatacgacaaactagcggcc
cttttagaagcaaatattcaaatggaccaactagaaaaaatcatgaaaggagaaaaaata
tgcgtatctacacaaaaaccggcgataaaggaatga

DBGET integrated database retrieval system