KEGG   Listeria monocytogenes HCC23 (serotype 4a): LMHCC_1742Help
Entry
LMHCC_1742        CDS       T00801                                 

Gene name
hemG
Definition
(GenBank) protoporphyrinogen oxidase
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
lmh  Listeria monocytogenes HCC23 (serotype 4a)
Pathway
lmh00860  Porphyrin and chlorophyll metabolism
lmh01100  Metabolic pathways
lmh01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lmh00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    LMHCC_1742 (hemG)
Enzymes [BR:lmh01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     LMHCC_1742 (hemG)
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     LMHCC_1742 (hemG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO NAD_binding_9 Pyr_redox_3 HI0933_like Thi4 Pyr_redox_2 FAD_binding_2 Pyr_redox Trp_halogenase FAD_oxidored GIDA
Motif
Other DBs
NCBI-ProteinID: ACK40083
Position
complement(1734604..1735983)
Genome map
AA seq 459 aa AA seqDB search
MKHIVIIGGGLSGLAAAYELQKTHPNYTWELVEKDEKLGGKFETVKRDGFLIEKGPDSFL
ARKPAGVGLVKDLGLEDKLIANATGRSYIYHQKALHPIPEGSVMGIPTDKEALLASTLVS
EIGKARALQEPTMERNNQEQDQALGDFFEARFGKELVKTIIEPLLSGIYAGDIYKMSLRA
TFPQFEQTVKKYGNLMDGLKESSMQTTGTKATIGAFRTLEGGLDTLPKAIAAALPKGNLH
TAKQATNITKKNSSYEISFADGDKMEADGVIIAATHDALIHLLAEKTTEPFAGQPLTTLA
TVSLAYNEQDVPILPDGTGYLVARTAPYKTTACTWVQKKWPHMVPKNKMLLRGFVGKAGE
TWLEQASDEAIVSAVLTDYAEIMDLHAAPLFYEVSRMKSAMPQYLVNHQDRLKQLKKNVK
ADYPGVYFAGMSYEGVGIPDCIAGAQTAINELAEYLEEV
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
gtgaaacatatagtcattatcggaggcggcttatcagggctcgcagcagcgtatgaacta
caaaaaacacatccgaattatacttgggaattagtagaaaaagacgaaaaactaggcgga
aaatttgaaacggtcaaacgggacggatttttaattgaaaaaggaccagactccttttta
gcaagaaaaccagctggtgtaggcttagtgaaggatttaggactcgaagataaactgatt
gcgaatgcgaccggaagatcctatatttatcatcaaaaagcgcttcatccgattccagaa
ggctctgtgatgggaattccgacagacaaagaagcgctgctagcaagcacactcgtatcg
gaaattggcaaagcacgagcacttcaagaaccaacaatggaacggaataatcaagaacaa
gatcaagcacttggcgatttctttgaagcgcgattcggtaaagaattagtcaaaacaatt
atcgaaccacttttatcaggaatttatgccggggatatatacaaaatgagtttacgcgcc
acttttccacaattcgaacaaacggttaaaaaatatggaaatttgatggatggtttgaaa
gaaagtagcatgcaaacgactggtacaaaagcaactattggcgcttttcgaacattagaa
ggcgggctagacactttaccaaaagccattgcggccgcacttccaaaaggaaatttgcat
acagcaaaacaagcaaccaacattacgaaaaagaatagctcttacgaaatctcgtttgca
gatggcgataaaatggaagcagatggcgtcattattgctgccacacatgatgcgttaatt
catttgttagctgaaaaaacgacagaaccattcgcgggacaaccgcttacgactctcgca
actgtctcattagcatacaatgaacaagatgtaccgattttaccagacgggacgggctac
ttagttgccagaaccgcgccgtataaaactactgcctgtacttgggtgcagaaaaaatgg
ccgcatatggtgccaaagaataaaatgttactacgaggctttgtcggaaaagcaggggaa
acttggttagagcaagcaagcgatgaagcaatcgtctctgctgttttgacagattatgcg
gaaattatggaccttcacgccgcgccgcttttttatgaagtaagccgaatgaaatccgcg
atgccacaatacttagtcaatcaccaagataggctaaaacaattgaaaaagaacgtcaag
gcagattacccaggtgtctattttgcaggaatgagttacgaaggtgtgggtattcctgat
tgcatcgctggggcacaaacagccattaatgaattagcagaatacttggaagaggtgtaa

DBGET integrated database retrieval system