KEGG   Listeria monocytogenes HCC23 (serotype 4a): LMHCC_2063
Entry
LMHCC_2063        CDS       T00801                                 

Gene name
hisG
Definition
(GenBank) ATP phosphoribosyltransferase
  KO
K00765  ATP phosphoribosyltransferase [EC:2.4.2.17]
Organism
lmh  Listeria monocytogenes HCC23 (serotype 4a)
Pathway
lmh00340  Histidine metabolism
lmh01100  Metabolic pathways
lmh01110  Biosynthesis of secondary metabolites
lmh01230  Biosynthesis of amino acids
Module
lmh_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:lmh00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    LMHCC_2063 (hisG)
Enzymes [BR:lmh01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.17  ATP phosphoribosyltransferase
     LMHCC_2063 (hisG)
SSDB
Motif
Pfam: HisG
Other DBs
NCBI-ProteinID: ACK40402
UniProt: B8DA57
Position
2041722..2042363
AA seq 213 aa
MKALKIALTKGRLEKDAVALLEKAGIDCSSMTDKKRKLIFHSSTQPISFILVKAVDVMTY
VKHGVADIGIVGKDVLMEASKSHYEMLDLEIGKCQFCLASTPDFDPSSYRRKIIATKYPT
VASKFFREKGEDVEIIKIEGSVEIAPVLGLADAIIDIVETGSTLKENGLLIYEKMYPISA
RLIVNKASLKQNKTQIFQLIDQLEQAIKEERIE
NT seq 642 nt   +upstreamnt  +downstreamnt
atgaaagctctaaaaattgctctaacgaaaggtcgactggagaaagacgcagtggcactt
ttggaaaaagctgggattgactgttcttctatgacagataaaaagcgtaaactaattttt
catagtagcactcaaccaatctcttttattttagtaaaagcggtcgatgtcatgacttac
gtaaagcacggggttgcggatattggcatcgttggtaaagacgttttaatggaggcatct
aaatcccattatgaaatgctcgaccttgaaatcggcaaatgccagttctgccttgcttct
acacctgactttgacccgagcagttatcgacgaaaaatcatcgcaaccaagtatccaact
gttgcttccaaatttttccgtgaaaaaggcgaagatgtagaaattatcaaaatcgaagga
tccgtcgagattgctccagtgcttggtcttgctgatgccatcatcgatatcgtcgaaact
ggctccactttaaaagaaaatggcttacttatttatgaaaaaatgtatccaatctccgcc
cgtctgattgtcaataaagcttccttaaaacagaacaaaacgcaaattttccaattaatc
gaccaattagaacaagcgataaaggaggaacgcatcgaatga

DBGET integrated database retrieval system