KEGG   Listeria monocytogenes HCC23 (serotype 4a): LMHCC_2452Help
Entry
LMHCC_2452        CDS       T00801                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K03478  chitin disaccharide deacetylase [EC:3.5.1.105]
Organism
lmh  Listeria monocytogenes HCC23 (serotype 4a)
Brite
KEGG Orthology (KO) [BR:lmh00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    LMHCC_2452
Enzymes [BR:lmh01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.105  chitin disaccharide deacetylase
     LMHCC_2452
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YdjC
Motif
Other DBs
NCBI-ProteinID: ACK40787
UniProt: B8DGN4
Position
complement(2439191..2439928)
Genome map
AA seq 245 aa AA seqDB search
MKIIFNADDFGISPGAVYGILESYKRGVVKSTTLLANSPAFDLAVEVAKENPGLDIGAHL
TLTFGSPVLQGLETLTDDDGRFRRNYTALENGLADVDMNEVERELTAQIEKILDAGITIS
HFDTHHSIEPLIYPVQHKLAEKYGVSIRRHSDVSDFGAIKTPDLFATEFYADGVSFETIK
KLVQEHIGTNDVVEVMTHPAYIDETLREISSYVEPRIKEVSILTSRELQAYLGQQEVEII
SFRDL
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattatttttaatgcagatgattttggaattagcccaggagcagtttacggtatt
ttagagtcttataagcgaggcgttgtgaaatctaccacgctgctagctaatagtccggcg
tttgatttggcagtagaagtagcgaaagaaaacccaggtctcgatattggtgcgcatttg
accctgacgttcggttctccagtccttcaaggtctagaaacgctaacggatgatgatgga
cgtttccgcagaaattatacagcacttgaaaatggattagcggatgtggatatgaacgag
gtggaacgagagttaactgcacaaatcgagaaaattttagatgcaggcattactatttct
cactttgatacacatcactcgattgagccgttaatttatcctgtacaacataaactggca
gaaaaatacggtgtgagcattagacgtcattctgatgtttcagattttggagctataaaa
acacctgatttatttgctacagagttttatgcagacggtgtatcttttgaaacaatcaaa
aaattagtgcaagagcatattggaacgaatgatgtagtcgaagtaatgacgcatcctgca
tatattgatgaaacattgcgcgagatatctagttatgtagagccgcgcatcaaagaagtt
tcgattctaacttcaagagaattacaagcatatttaggccaacaagaagtagagattatt
agttttcgtgatttataa

DBGET integrated database retrieval system