KEGG   Leishmania mexicana: LMXM_10_0730
Entry
LMXM_10_0730      CDS       T02288                                 

Definition
(RefSeq) putative deaminase
  KO
K15441  tRNA-specific adenosine deaminase 2 [EC:3.5.4.-]
Organism
lmi  Leishmania mexicana
Brite
KEGG Orthology (KO) [BR:lmi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:lmi03016]
    LMXM_10_0730
Enzymes [BR:lmi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.-  
     LMXM_10_0730
Transfer RNA biogenesis [BR:lmi03016]
 Eukaryotic type
  tRNA modification factors
   Deaminases
    LMXM_10_0730
SSDB
Motif
Pfam: dCMP_cyt_deam_1 MafB19-deam Bd3614-deam
Other DBs
NCBI-GeneID: 13454772
NCBI-ProteinID: XP_003872911
UniProt: E9AN83
Position
10
AA seq 281 aa
MSVHYVDAFMRAALKEAELALEEGEVPVGCVLVRTDTNETVYAKLALQLSDDVVNASPHA
APPLSCDQLVESCIAARGRNQTNLQHHALAHAEFIAAQKLIDSATRGGDGSAGARSSKAG
AGEGENGLVEEEKESGSTSSPTTPPLSGLADYVLYVTVEPCVMCGAMLLYNRIAHVFFGC
RNPRFGGNGTVLALHTSPFQQQRLLQQPSQPDQSAASMPHFVGTSKGSPSADEGGVVCSG
EWWPGYVSEGGHTEAEAISLLQRFYERENPNAPGHKRRRKA
NT seq 846 nt   +upstreamnt  +downstreamnt
atgtctgtgcactatgtcgatgccttcatgcgcgcggccctcaaggaagccgagctggcg
ctggaagagggtgaagtgcctgttggctgcgtgctggtgcgcacggacaccaatgaaacg
gtgtacgcgaagctcgcgctgcagctgtcggacgatgtggtcaatgcgtcacctcacgca
gccccgccgctcagctgcgaccagctggtcgagtcgtgcatcgctgcgcgtggccgtaat
caaacgaatctgcagcaccatgccctggcccacgcagagttcatcgccgctcagaagctt
atcgatagtgcaacgagaggcggagacggaagcgcgggtgcgaggtcaagtaaagccggt
gctggcgaaggagagaacggactcgttgaggaagagaaagaaagcggatcgacctcctca
ccaactaccccgccactgtccggcctggctgactatgtcctctacgtcactgttgaaccg
tgcgtgatgtgcggtgcgatgctgctctacaaccgtatcgctcacgtctttttcggctgt
cgaaacccgcgctttggcggcaacggcaccgtcttggcgctgcacacgtcaccttttcaa
cagcagcggctgctgcaacagccttcgcaaccagatcagtcagcagccagcatgccacac
ttcgtgggcacgtcgaagggctcgcccagcgctgatgagggtggggtcgtctgtagtggt
gagtggtggcccgggtacgtgagtgagggcggtcataccgaggcagaggccatcagcctc
ctccaacgcttctacgagcgggagaaccccaacgccccggggcacaagcgccgccggaag
gcttga

DBGET integrated database retrieval system