KEGG   Leishmania mexicana: LMXM_16_1310Help
Entry
LMXM_16_1310      CDS       T02288                                 

Definition
(RefSeq) putative cytochrome c
  KO
K08738  cytochrome c
Organism
lmi  Leishmania mexicana
SSDB OrthologParalogGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3
Motif
Other DBs
NCBI-GeneID: 13450152
NCBI-ProteinID: XP_003873819
UniProt: E9AQU2
Position
16
AA seq 113 aa AA seqDB search
MPPKARPPLPPGDVERGEKLFKGRAAQCHTATKGGSNGVGPNLFGIVHRPSGKVEGFTYS
KANADSGVIWTPEVLDVYLENPKKFMPGTKMSFAGIKKPQERADVIAYLETLK
NT seq 342 nt NT seq  +upstreamnt  +downstreamnt
atgccgccgaaggctcgtcctcccctgccgcctggtgacgtggagcgcggcgagaagctg
ttcaagggccgcgctgcccagtgccacactgccaccaagggtggctccaacggtgtgggc
ccgaacctgttcggcatcgtccaccgcccctccggcaaggtcgagggcttcacgtacagc
aaggcgaacgccgattccggcgtaatctggacgccggaagtgctggacgtgtacctggag
aacccgaagaagttcatgcctggcacgaagatgtcgtttgccggcatcaagaagccgcag
gagcgcgccgacgtgattgcgtacctcgagaccctcaagtaa

DBGET integrated database retrieval system