KEGG   Leishmania mexicana: LMXM_25_2130Help
Entry
LMXM_25_2130      CDS       T02288                                 

Definition
(RefSeq) putative succinyl-CoA synthetase alpha subunit
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
lmi  Leishmania mexicana
Pathway
lmi00020  Citrate cycle (TCA cycle)
lmi00640  Propanoate metabolism
lmi01100  Metabolic pathways
lmi01110  Biosynthesis of secondary metabolites
lmi01130  Biosynthesis of antibiotics
lmi01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:lmi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    LMXM_25_2130
   00640 Propanoate metabolism
    LMXM_25_2130
Enzymes [BR:lmi01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     LMXM_25_2130
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     LMXM_25_2130
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2
Motif
Other DBs
NCBI-GeneID: 13449022
NCBI-ProteinID: XP_003876272
UniProt: E9AXU6
Position
25
AA seq 299 aa AA seqDB search
MLARSAIRRWVNKDTKVIVQGMTGKAGTFHTKEAMAYGTKVVGGVSPKKAGTTALGVPVF
ATAAEAVKATGATASVLYVPAPSCAASIEEALDAELPLVVVITEGIPQWDMLRVKSMLLS
QNKTRLIGPNCPGIIKPAECKIGIMPGHIHKRGKIGIVSRSGTLTYEAVAQTTAEGLGQS
LCVGIGGDPFNGTNMVDCLRLFLNDPETEGIILIGEIGGTAEEEAADFIKNSPIKKPIVS
FIGGATAPPGRRMGHAGAIVSGGMGTAKGKKEALRAAGVTISDSPAHLGKHMAELFSTK
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgctcgcccgctccgccatccgccgctgggtcaacaaggacacgaaggtgattgtccag
ggcatgaccggcaaggccggcacgttccacacgaaggaggcgatggcgtacggcaccaag
gtcgtgggcggcgtgagcccgaagaaggcgggcacgacggcgctgggcgtgccggtgttt
gcgacggctgcggaggcggtgaaggcgacgggcgcgacggcgtcggtgctgtacgtgcct
gcgccctcgtgcgctgcgtcgatcgaggaggctctggacgcggagctgccgctggttgta
gtgatcacggagggcatcccgcagtgggacatgctgcgcgtgaagtcgatgctgctgtcg
cagaacaagacgcgcctgatcggcccgaactgcccaggcatcatcaagcctgcggagtgc
aagatcggcatcatgcccggccacatccacaagaggggcaagatcggcattgtgtcgcgc
agcggcacgctgacgtacgaggcggttgcgcagacgacggcggagggcctcggccagtcg
ctgtgcgtcggcattggcggcgacccgttcaacggcacgaacatggtggactgcctgagg
ctgttcctgaacgaccccgagacggagggcatcatactgattggcgagatcggtggcacg
gcggaggaggaagcggcggacttcatcaagaacagcccgatcaagaagccgatcgtgtcc
ttcatcggcggggcgactgcgccgccgggccgccgcatgggccacgccggtgctatcgtg
tctggcgggatgggcaccgcgaagggcaagaaggaggcgctgcgcgccgccggcgtgacc
atctccgactcgccggcgcaccttggcaaacacatggctgagctcttctccacgaagtag

DBGET integrated database retrieval system