KEGG   Leishmania mexicana: LMXM_28_0210Help
Entry
LMXM_28_0210      CDS       T02288                                 

Definition
(RefSeq) histone H2B variant
  KO
K11252  histone H2B
Organism
lmi  Leishmania mexicana
Brite
Chromosome and associated proteins [BR:lmi03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    LMXM_28_0210
Exosome [BR:lmi04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   LMXM_28_0210
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CBFD_NFYB_HMF Cylicin_N
Motif
Other DBs
NCBI-GeneID: 13450515
NCBI-ProteinID: XP_003876854
UniProt: E9AZI2
Position
28
AA seq 142 aa AA seqDB search
MPPTKGGKRPIPLGGKGKGKRSAGKAPKSGNDHKRRHNQKRSQHWDLYIHRALRRFFKRG
TLSKAAVRVLSSFIEDMFNRIQTEAVFVAKINKVKTLTAREIQTSARLLLPPELAKHAMS
EGTKAVAKYNASRGEAYAQGGI
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
atgccgccaaccaagggtggaaagcgcccgatcccgctggggggtaagggcaagggcaag
cgctcggcgggtaaggcacccaagtcgggcaatgatcacaagcgccgccacaaccaaaaa
cgcagccagcactgggacctgtacatccaccgcgctctgcgccgcttctttaagcgcggc
acgctgagcaaggcggccgtgcgcgtgctttcctcctttattgaagacatgttcaaccgc
atccagaccgaggccgtctttgtcgctaagatcaacaaggtgaagaccctgaccgctcgc
gaaatccagacgtcggcccgtctgctgctgccgccggaactggcgaagcacgccatgagc
gagggcaccaaggctgtcgccaagtacaacgcttctcgcggtgaggcgtatgctcagggt
ggcatttag

DBGET integrated database retrieval system