KEGG   Leishmania mexicana: LMXM_28_2820Help
Entry
LMXM_28_2820      CDS       T02288                                 

Definition
(RefSeq) putative heat shock protein 70
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
lmi  Leishmania mexicana
Pathway
lmi03040  Spliceosome
lmi04141  Protein processing in endoplasmic reticulum
lmi04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:lmi00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    LMXM_28_2820
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    LMXM_28_2820
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    LMXM_28_2820
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:lmi01009]
    LMXM_28_2820
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:lmi03041]
    LMXM_28_2820
   03009 Ribosome biogenesis [BR:lmi03009]
    LMXM_28_2820
   03110 Chaperones and folding catalysts [BR:lmi03110]
    LMXM_28_2820
   04131 Membrane trafficking [BR:lmi04131]
    LMXM_28_2820
   03051 Proteasome [BR:lmi03051]
    LMXM_28_2820
   03029 Mitochondrial biogenesis [BR:lmi03029]
    LMXM_28_2820
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lmi04147]
    LMXM_28_2820
Protein phosphatases and associated proteins [BR:lmi01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     LMXM_28_2820
Spliceosome [BR:lmi03041]
 Complex B
  Other components
   Prp19 complex
    LMXM_28_2820
 Complex C
   Prp19-CDC5 complex
    LMXM_28_2820
Ribosome biogenesis [BR:lmi03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    LMXM_28_2820
Chaperones and folding catalysts [BR:lmi03110]
 Heat shock proteins
  HSP70 / DNAK
   LMXM_28_2820
Membrane trafficking [BR:lmi04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    LMXM_28_2820
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    LMXM_28_2820
Proteasome [BR:lmi03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    LMXM_28_2820
Mitochondrial biogenesis [BR:lmi03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    LMXM_28_2820
Exosome [BR:lmi04147]
 Exosomal proteins
  Proteins found in most exosomes
   LMXM_28_2820
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FtsA BcrAD_BadFG Phage_TAC_11 Raco_middle
Motif
Other DBs
NCBI-GeneID: 13450222
NCBI-ProteinID: XP_003877126
UniProt: E9B0A4
Position
28
AA seq 661 aa AA seqDB search
MSFTEEFDGAIGIDLGTTYSCAAVFVRGQAEVIPNDMGNRTTPSCVAFYNDDVLVGDAAK
TLLGRGVSGVVFDAKRMIGHHFSDKSIQEDRTRWPFPISEGVKNSIQINVTHKGEELQLA
PEQISAKVLVYLKECAERYLGKQVKKAVVTVPAYFNDSQRERTKAAATIAGLEVLRIINE
PTAAALCYGLGVGSGTGQQQGEDRPHNVVVFDFGGGTFDVSVIVIDSGSFAVQATAGDTH
LGGQDIDSNLLKYVLDDLQSRYSLSIAEQPRLLAKARTACERVKRVLSQSTAEELALDGV
LLSGEEYTLSVSRAKLEELNASVFAQCMKVVKRALQDAGMKVEDVHEVVLVGGSSRIPKL
NDMLRAFFNKERLCNSVHPDEAVAIGAAVQASILTNSLEQQSEKTANVVLMDVVPLSIGV
EIDDGKFDVIVPRNTTIPYKATKEYSTVEDYQQDVDVCVYEGERPLTKHNHKLGEFTLEG
ITRAKKGKPTITVTFSIDANGLLTITGTEELANKRHTLVVQNVDRLSEAQVKEMIEMSKK
FAKSDAVDDARETARRTVKGALETLSAAIAAMPPPPPSQLQKRLDAFTSHTHDWLERQLP
SYSTVAEMEEKAKQIEKLARKAVKKVKKARGGEPASKRHRDEGNGGNESSSGSDAENDAD
K
NT seq 1986 nt NT seq  +upstreamnt  +downstreamnt
atgagcttcacagaggagtttgatggtgccatcggcatcgatctcggcacgacgtactcg
tgcgccgccgtcttcgtgcgcgggcaggcggaggtgatcccgaacgacatgggcaaccgc
accacaccatcgtgcgtggccttctacaacgatgacgtgctcgtcggcgacgctgccaaa
acgctgctcggtcgcggcgtctctggtgtcgtgttcgatgcgaagcgcatgattggtcac
cacttcagcgacaagagcatccaagaggaccgcacccgctggccgttccctatctcagag
ggtgtaaagaacagcattcagatcaacgtgacgcacaagggcgaggagctgcagctggca
ccggagcagatctctgccaaggtgctagtctacttgaaggagtgtgccgagcggtacctg
ggcaagcaggtgaagaaggccgtggtgacggtgccggcgtacttcaacgactcgcagcgc
gagcgcaccaaggcggcggcaacgattgctggcctggaggtgctgcgcatcatcaacgag
ccgacggcggcggcgctgtgctacggcctcggcgtcggcagtggcacagggcaacagcaa
ggcgaggaccggccgcacaatgtcgtcgtcttcgacttcggcggcggcacttttgatgtg
tccgtcatcgtcatcgacagcgggagcttcgcggtacaggcgaccgccggtgacacccac
ctaggcgggcaggacattgactcgaaccttctcaagtacgtgctagacgatttgcagtcg
cgatacagcctcagcatcgccgagcagccgcgtctgctcgcgaaggcccgtacagcgtgc
gagcgggtgaagcgggttctgtcgcagtcaacagccgaagaactggccctggatggtgtg
ttgctgagcggcgaggagtatacgctgtctgtctcccgcgcaaagctggaggagctgaac
gcgtctgtgtttgcgcagtgcatgaaggtggtgaagcgcgccttgcaggatgcaggcatg
aaggtggaagacgtccatgaggtcgtgctcgtcggcggcagctcgcgcatcccgaagctg
aacgacatgcttcgcgcctttttcaacaaagagcgactgtgcaactcagtgcacccggac
gaggcggtggccatcggtgccgcggtgcaggccagcatcctcaccaactcgcttgagcag
cagtccgagaagacggccaacgtcgtgctcatggatgtggtaccgctgagcatcggcgta
gagatcgacgatggcaagttcgacgtcattgtcccccgcaacacgaccattccgtacaag
gcgacgaaggagtacagcacagtcgaagactaccagcaagacgttgacgtgtgcgtgtac
gagggagagcggccgctgacaaaacataaccacaagctgggcgagttcacactcgagggc
atcacccgtgccaagaagggcaagcccaccatcacggtgaccttctccatcgacgcgaac
ggccttctcaccatcaccggcacggaggagttggccaacaagagacacacgctcgtcgtg
cagaacgtcgaccggctctccgaggcgcaggtgaaggagatgatcgaaatgtcgaagaag
ttcgccaagagcgatgctgtggacgacgccagagaaacggcgcgacggacggtgaaaggc
gcactcgagactctctccgctgccatcgccgcgatgccgccgccgccgccgtcacagctg
cagaagcggcttgatgcctttacttcgcatacgcatgactggctcgagcgacagctgccc
tcctactcgaccgtcgccgagatggaggagaaagcgaagcagatcgaaaaactcgccagg
aaagcggtgaagaaggtgaagaaggcgcgcggcggtgagccggcctcgaagcgccaccgc
gacgagggaaacgggggcaacgagtcctccagcggcagcgacgcggaaaacgatgcggac
aagtga

DBGET integrated database retrieval system