KEGG   Leishmania mexicana: LMXM_30_2340Help
Entry
LMXM_30_2340      CDS       T02288                                 

Definition
(RefSeq) putative p-nitrophenylphosphatase
  KO
K01101  4-nitrophenyl phosphatase [EC:3.1.3.41]
Organism
lmi  Leishmania mexicana
Brite
Enzymes [BR:lmi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.41  4-nitrophenylphosphatase
     LMXM_30_2340
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_6 Hydrolase_like PGP_phosphatase Hydrolase HAD_2
Motif
Other DBs
NCBI-GeneID: 13451999
NCBI-ProteinID: XP_003877754
UniProt: E9B234
Position
30
AA seq 364 aa AA seqDB search
MPERMTAALAAQLVSSPLKYVLLDIDGVIWCGGHVIDRVPETLQYLRGQGKRIRFLSNNA
SLSREQLMQSLKAKGIEGVTVKECYNSAYTAALRLKQLLGKPDVPGEEPLVHGNVFVIGE
QGLHDELQQVLAPGFITYGVELHDAERAGGYDTDALGSAWRVPSLPPPRKRLVVCNGKAC
RMVQADANNTEKISLSDLNAAAVVVGLDKHFNMLKLAYGSLVLQGPPQDLREESYTPPLF
LATNEDPQLPVGRDAAMIPGAGSMVNALCTAVGKRPDAVCGKPHKDMADILFEAEGITNP
REECIMIGDRLTTDVVFGNAAGCQSMLVLSGVEGLTDVEEAEKQGKTTLVPKYVAESLAC
FLPS
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgccagagcgaatgacagcagcgctagctgcgcaactggtatcctcgcctctgaagtac
gtgctgctcgatattgacggcgtcatctggtgcggcgggcacgtgatcgaccgtgtacca
gagacgctgcagtacctgcgcggccaaggcaagcgaatccgctttctctcgaacaacgcg
tcgctatctcgcgagcagctgatgcagagcctcaaggctaagggaatcgagggcgtgaca
gtgaaagagtgctacaacagcgcgtacactgcggcgctgcggctgaagcagctgctgggt
aagccagacgtgcctggcgaggagcctctagtgcacgggaatgtgttcgtgattggtgag
caggggctgcatgacgagctgcagcaggtacttgccccggggttcatcacttacggcgtg
gagctgcacgatgcagagcgtgctggaggatacgacacggatgcgcttggcagcgcgtgg
cgcgttccgtccctgccgccgccgcggaagcgcctggtggtgtgcaatggcaaagcatgc
cgcatggtgcaggccgacgcgaacaacacggagaagatttcgctctccgacctgaacgcc
gctgctgtcgtcgttgggctcgacaagcatttcaatatgctcaagctggcgtacgggtca
cttgttctgcaaggtccacctcaggacctgcgcgaagagtcgtacacgccgccattgttc
ctagccacgaacgaggaccctcagctgccggtcggtcgcgatgccgccatgatcccaggc
gctgggtccatggtgaacgctctgtgcaccgctgtcggaaagcggccggacgccgtgtgt
gggaagcctcacaaggacatggcggatatattgttcgaggccgagggtatcacgaatccg
cgagaggagtgcatcatgatcggtgaccggctaaccacggacgtggtgtttggcaatgcg
gccggatgccagagcatgctcgtgctgagcggcgtcgaagggttgacggatgtggaggag
gcagagaagcaaggcaagacaactctggtgccaaaatacgttgccgagtctctcgcctgc
ttcttgccatcatga

DBGET integrated database retrieval system