KEGG   Leishmania mexicana: LMXM_31_2320
Entry
LMXM_31_2320      CDS       T02288                                 

Definition
(RefSeq) putative C-14 sterol reductase
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
lmi  Leishmania mexicana
Pathway
lmi00100  Steroid biosynthesis
lmi01100  Metabolic pathways
lmi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lmi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    LMXM_31_2320
Enzymes [BR:lmi01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     LMXM_31_2320
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295 PEMT ICMT
Other DBs
NCBI-GeneID: 13453672
NCBI-ProteinID: XP_003878080
UniProt: E9B312
Position
31
AA seq 437 aa
MAKRRGTASKSEANSLQPRTKTYEWGGPVGALFMVAFLPTLVVALNSLCAGEQCSLMQAM
RLPALMKEVVQSARPMLRTAIGIELVWIAAHAVFSILPIGKLVHGSELRSGERLSYRMNA
IHAFVVAHLVLFGLHFTSTLNMAVVADLYHPLMIGAILISFAMSVVLYAASYRSRNVLTA
LGGNTGSVLYDFWVGRELNPRTGPLDWKLMCELRPGLIGWSILNWAFVCKSAELGTVTPS
IVLTALFESFYVLDGLLLEAGNLSMMDIVTDGFGFMLCFGDLAWVPFTYTLQTKYLVHHP
AHLSLVHLSLCASLTAAGYLIFRNANTEKDRFRKNPQDPRVQHLRVMKTSKGKSLIISGY
WGVCRHPNYVGDWLMALGWAAFSGTAELLPYFHPVYFGLLLMHRQLRDEQQMREKYGKED
WNAFCRVVKYRLFPYIY
NT seq 1314 nt   +upstreamnt  +downstreamnt
atggcaaaacgcagaggtactgcttccaagtcagaggcgaattctctgcagccccgcacg
aaaacctacgagtggggcggcccggtgggagccctcttcatggttgcttttctccccaca
ctggtggtagcgctgaacagcctgtgcgctggggagcagtgcagcctcatgcaggcaatg
cggctgcctgcactgatgaaggaggtggtgcagagcgcgcggccgatgctgcggacggcg
atcggcatcgagcttgtgtggatcgccgctcacgccgtattttccatcctccctattggc
aaactcgtccacggcagcgagctccgcagcggcgagcgactttcctaccgcatgaacgcc
atccacgccttcgttgtcgcgcacctcgtgctctttggcctgcacttcacctccaccctc
aacatggctgttgtggccgacctttaccaccccctcatgatcggcgccattcttatctcg
tttgccatgtcggtcgtgctgtacgcggcgtcgtaccgcagtcgcaacgtactcacggct
ctcggtggcaacaccgggagcgttctgtatgacttttgggtcggccgcgagctgaacccg
cgcaccggtccgctggactggaagctgatgtgcgaactgcgtcccggcctcattggctgg
agcattctcaactgggcattcgtgtgcaagtcggccgagctgggtaccgtgacgccgagc
atcgtgctcaccgcacttttcgagtctttctacgtcctggatggcctgctgctggaggcg
ggaaatctcagcatgatggacattgtgacggacggctttggctttatgctgtgctttggc
gaccttgcgtgggtaccgtttacgtacacgctgcagacgaagtacctcgtccaccacccc
gcgcacctctcgctcgtgcatctgtccctgtgcgcttcccttactgccgccgggtacctg
atcttccgcaatgcgaacacggaaaaggaccgcttccgaaaaaatccgcaggacccgcgc
gtgcagcacctgcgcgtcatgaagacctccaaaggcaagtccctcatcatctccggctac
tggggcgtgtgccggcacccaaactacgttggtgactggctgatggcgctcggctgggcg
gcgtttagcggcacggcagagttgctgccgtactttcatcctgtttactttggcctcctc
ctcatgcaccgtcagctgcgtgatgagcagcagatgcgagagaagtacggcaaggaggac
tggaacgcgttctgccgcgtcgtcaagtatcggctgttcccgtacatatactag

DBGET integrated database retrieval system