KEGG   Leishmania mexicana: LMXM_32_1380Help
Entry
LMXM_32_1380      CDS       T02288                                 

Definition
(RefSeq) putative map kinase
Organism
lmi  Leishmania mexicana
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo Haspin_kinase Kinase-like Seadorna_VP7 FTA2
Motif
Other DBs
NCBI-GeneID: 13453911
NCBI-ProteinID: XP_003878392
UniProt: E9B3X5
Position
32
AA seq 408 aa AA seqDB search
MPATKSLAELQAEVCRLDDRYLLERVIGAGSYGVVIRARDTKSDNRLVAMKRVNKEIFEE
VILAKRILREIKLLSHFNDDNIIGLRNILTPEDPENFDHFYIVMDIMETDLKQVLRSGQE
LTEAHIQFFIYQALRALHIIHSAGVIHRDITPANILVNTNCDLKICDFGLAKEENDQGEY
MTDYVTMRWYRAPELVMEDKDYSAQIDVWGIGCILGELLGSRPLFQGKDRVNQLDKIVDV
IGTPSEEDINSVGSSAAQKYLKKKSHRPQADWRQRYPKASSEALDLLRRMLVFNPKRRIT
VLQAMRHPFLVQLHDDADDNISYTLFRFDENEQKTIVDVKRAIYQESVKFHNEHPSSMRA
TTMYSAFNTPSVAAPSVATEGEGRSAQQTIEKNIPENAGDGNFDRDQV
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgccggccaccaagtcactagcggagctgcaggcagaggtctgccgcctggatgaccgc
tacctgctggagcgcgtcatcggcgccgggtcctatggtgttgtgattcgcgcgcgtgac
accaagagcgacaaccgcctcgtcgccatgaagcgcgtgaacaaggaaatctttgaggag
gttattctggcgaagcgcattctgcgcgagatcaagctgctgtcgcacttcaatgacgac
aacatcattggcctgcgcaacatcctcaccccggaggacccagagaactttgaccacttc
tacatcgtaatggatattatggaaaccgacctgaagcaggtgctgcgcagtgggcaggag
ctgacggaggcgcacattcagttcttcatctaccaggcactgcgtgcgctgcacattatt
cacagcgccggcgtcatccaccgcgatattacgccggcgaacattctggtgaacacgaac
tgcgacttgaagatttgtgacttcggcctggcgaaggaggaaaacgatcaaggcgagtac
atgacggactacgtgacaatgcgctggtaccgtgcgccggagttggtgatggaggacaag
gattactcggcgcagattgatgtgtggggcatcggctgcatcctcggcgagctactcggc
tctcggccgctcttccaggggaaagaccgggtgaaccagttggacaagatagtcgatgtg
atcggtacgccgtctgaggaggacatcaactccgtaggatcgtctgctgcgcagaagtac
ctcaagaagaagagtcaccgaccgcaagctgactggcggcagcgctacccaaaggcgtct
tcggaggcgctcgacctgctgcgccgcatgctggtcttcaacccgaagcggcgaatcacg
gtgctgcaggcgatgcgtcacccgttcctggtgcagctgcacgacgacgcagatgataac
atcagctacactctcttccgctttgacgagaacgagcaaaagacgatagtggatgtgaag
cgcgccatctaccaagagagtgtcaagtttcacaatgagcatccatcctcgatgcgggca
acgaccatgtacagcgccttcaacacccccagcgtggccgcaccgagcgtggcaacagag
ggcgagggccgctcggcgcagcagacgattgagaagaacatcccagagaacgcgggagac
ggcaattttgaccgtgatcaggtctga

DBGET integrated database retrieval system