KEGG   Leishmania mexicana: LMXM_36_1980
Entry
LMXM_36_1980      CDS       T02288                                 

Definition
(RefSeq) putative serine/threonine protein phosphatase 2B catalytic subunit A2
  KO
K04348  serine/threonine-protein phosphatase 2B catalytic subunit [EC:3.1.3.16]
Organism
lmi  Leishmania mexicana
Brite
KEGG Orthology (KO) [BR:lmi00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:lmi01009]
    LMXM_36_1980
Enzymes [BR:lmi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     LMXM_36_1980
Protein phosphatases and associated proteins [BR:lmi01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Catalytic subunits
     LMXM_36_1980
SSDB
Motif
Pfam: Metallophos
Other DBs
NCBI-GeneID: 13448727
NCBI-ProteinID: XP_003874547
UniProt: E9ASX3
Position
20
AA seq 407 aa
MSQPNMKCSAVGGRNLNGTPVERNTLLRDDKLSLESIMLQFLCGEQLRLEYAIEIVQQAA
LVLRTEPNALSINDAVVVVGDVQGQYYDLVKILAACGSLSTTTYLFLGNYIGNGGFNLEC
ILFLLAAKVAHPQSIFLIRGSNESKFMADILELGKECQLKYSSTLLPQILSAFNCLPLAA
IIRKKFFCVHSGLSPDVSHVDDIGLIHRFRHIPTRGAMCDMVWSEPDWDTNNQLYNNVEE
PSGETYVPRLGSFETRPLFITNKQRGLSYVFNFACAKRFVSANNLLCIIRAHEVHELGFK
LYRPHPNHLFPCIISLFSAPNYCSSFGNKGAVLVVSKETICFKQFEPSPHPCVLQGRNAF
SWSLPFLESNLMSIFLTLLSGSDFDPTVADRSEKGSSNGEGGATPLI
NT seq 1224 nt   +upstreamnt  +downstreamnt
atgagccaaccgaatatgaagtgctctgccgtggggggtcgcaacctcaacggcacgcct
gtagagcgtaacacattgctgagggatgacaagctgtcattggagagcattatgctgcag
tttctttgtggtgaacagcttaggctcgagtacgccatagaaattgttcagcaggctgca
cttgtccttcgaacggagccaaacgcgctttccattaacgacgctgtagttgttgtcggg
gatgttcagggccaatactacgatttggtgaagattttagcggcttgcggctccttgagc
acgaccacgtacctttttctgggcaactacatcggcaatggaggattcaacttggaatgt
attcttttcctgctggcagcgaaagttgctcacccgcagtcgatttttttgatccgagga
agcaatgaatctaaatttatggcagacattcttgaactcggcaaggagtgccagctcaag
tactctagcactttgttgccgcagatactctcggcgttcaactgtttgccactggcggcc
ataatccgaaaaaagtttttctgcgttcactcgggactctccccagacgtgtcacatgta
gacgacattggactgattcaccgcttccggcacattccaacgcgaggggcgatgtgtgat
atggtgtggtctgagccggattgggacaccaacaatcagctgtacaacaatgttgaggag
ccttcgggtgaaacatatgttccacgactcggttcgttcgagacacgaccactcttcatc
acgaacaagcagcggggtctcagctacgtgttcaactttgcgtgtgcaaaacgttttgta
tcggcaaacaaccttctctgtatcattcgagctcacgaggttcatgagctcgggtttaaa
ctgtatcgcccgcacccaaaccacctgttcccttgcataatttctctcttttcggctcca
aattactgctccagcttcggcaacaaaggagcagttttagtggtctcaaaggaaactatc
tgctttaagcagttcgagccttcacctcatccatgcgtactgcaaggtcgaaacgcattt
tcgtggtctctaccattcttggagagcaacctcatgtccattttcctgaccctcttgtca
ggctccgattttgacccaacggttgctgacagatctgaaaagggctcgagcaacggagag
ggaggtgccacgccactcatttga

DBGET integrated database retrieval system