KEGG   Lautropia mirabilis: NCTC12852_00448Help
Entry
NCTC12852_00448   CDS       T05799                                 

Gene name
gshB
Definition
(GenBank) Glutathione synthetase
  KO
K01920  glutathione synthase [EC:6.3.2.3]
Organism
lmir  Lautropia mirabilis
Pathway
lmir00270  Cysteine and methionine metabolism
lmir00480  Glutathione metabolism
lmir01100  Metabolic pathways
Module
lmir_M00118  Glutathione biosynthesis, glutamate => glutathione
Brite
KEGG Orthology (KO) [BR:lmir00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    NCTC12852_00448 (gshB)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    NCTC12852_00448 (gshB)
Enzymes [BR:lmir01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.3  glutathione synthase
     NCTC12852_00448 (gshB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSH-S_ATP GSH-S_N RimK ATPgrasp_YheCD
Motif
Other DBs
NCBI-ProteinID: VEG99850
Position
1:complement(564486..565451)
Genome map
AA seq 321 aa AA seqDB search
MDILFILDPFDSLKPKKETSIAMMRAAVARGHRVFGCLQGDISLDQGKVTARVTPLELTG
ELSPWYKAGEVRTEPLSAFDAVLMRKDPPFDMEYVYSTYMLERAVEQGARVYNNPAAIRD
HNEKFSITAYPQLTTDVMVTRDPARLREFVARHGEAVLKLLDGMGGASIFRARQDDPNLS
VILETMNRFGTRTVMAQRYLPAIAQGDKRILLIDGEVVPHALARIPQAGEARGNMAAGGK
PVAQPLSARDEEIARYLGPRLAAKGLFLVGLDVIGDSLTEINVTSPTGFMEITAQTGFDV
PDFFIAQLEKRVAADRSAAGA
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atggacattcttttcatcctcgatcccttcgattccctcaagcccaagaaagagaccagc
atcgccatgatgcgggccgctgtggcgcgtggccaccgggtcttcggttgcctgcagggt
gacatcagtctggatcagggcaaggtcacggcccgggtgacgccgctggagctgaccggc
gagctctccccctggtacaaggccggcgaggtgcgcaccgagcctctgtcggctttcgat
gccgtgctgatgcgcaaggatccgcccttcgacatggaatatgtctattccacctacatg
ctggagcgggcggtcgagcagggggcacgggtctacaacaatcccgccgccatccgcgac
cataatgagaaattctccattacggcctatccgcagctgaccaccgacgtgatggtcacg
cgcgatccggcccggctgcgcgagtttgtcgcccgccatggcgaggcggtgctgaagctg
ctggacggcatgggtggggcctccatcttccgggcacgtcaggatgatcccaacctgtcg
gtcattctggaaaccatgaaccgcttcggcacgcgcaccgtgatggcgcagcgctacctg
ccggccatcgcgcagggcgacaagcgcatcctgctcatcgacggtgaggtggtgccgcac
gcgctggcgcgcatcccgcaggccggcgaggcgcggggcaacatggcggccggcggcaag
ccggtggcgcagccgctgtcggcgcgtgatgaagagatcgcccgctacctgggcccgcgc
ctggcagccaagggacttttcctggtgggtctggacgtgattggcgacagcctcaccgag
atcaacgtcaccagccccaccggtttcatggaaatcacggcgcagaccggtttcgatgtg
cccgatttcttcattgcacagctggaaaagcgtgtggcggccgatcgttccgccgccggg
gcctga

DBGET integrated database retrieval system