KEGG   Listeria monocytogenes J0161: LMOG_00287Help
Entry
LMOG_00287        CDS       T01987                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
lmj  Listeria monocytogenes J0161
Pathway
lmj00071  Fatty acid degradation
lmj00072  Synthesis and degradation of ketone bodies
lmj00280  Valine, leucine and isoleucine degradation
lmj00310  Lysine degradation
lmj00362  Benzoate degradation
lmj00380  Tryptophan metabolism
lmj00620  Pyruvate metabolism
lmj00630  Glyoxylate and dicarboxylate metabolism
lmj00640  Propanoate metabolism
lmj00650  Butanoate metabolism
lmj00900  Terpenoid backbone biosynthesis
lmj01100  Metabolic pathways
lmj01110  Biosynthesis of secondary metabolites
lmj01120  Microbial metabolism in diverse environments
lmj01130  Biosynthesis of antibiotics
lmj01200  Carbon metabolism
lmj01212  Fatty acid metabolism
lmj02020  Two-component system
Brite
KEGG Orthology (KO) [BR:lmj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    LMOG_00287
   00630 Glyoxylate and dicarboxylate metabolism
    LMOG_00287
   00640 Propanoate metabolism
    LMOG_00287
   00650 Butanoate metabolism
    LMOG_00287
  09103 Lipid metabolism
   00071 Fatty acid degradation
    LMOG_00287
   00072 Synthesis and degradation of ketone bodies
    LMOG_00287
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LMOG_00287
   00310 Lysine degradation
    LMOG_00287
   00380 Tryptophan metabolism
    LMOG_00287
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LMOG_00287
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LMOG_00287
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    LMOG_00287
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lmj04147]
    LMOG_00287
Enzymes [BR:lmj01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     LMOG_00287
Exosome [BR:lmj04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LMOG_00287
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AEO03498
Position
complement(1444272..1445441)
Genome map
AA seq 389 aa AA seqDB search
MKEVVIIDAVRTPIGKFGGSLKDISAVDLGATALKGVLERANIAPERVDQVIFGNVLQAG
LGQNVARQIAIKAGIPYKVPGVTINEVCGSGLKSVMLGRQAIQLGEADIVAVGGTENMSQ
APLLLNPELAGEEINPKKLRNSMLIDGLTDVYGEYHMGITAENVAEKFSVTREEQDEFAH
NSQMKAASAQEKKLFEEEIIPVKLPDGSFFEADETIRANSTLEKLATLKSVFKEGGTVTA
GNASGINDGASAIILMSKEKAVAENIPYIATIKVTSEVGVDPALMGYAPYYAVNEALTKG
GYSIDEIDLFHLNEAFASQSVAVARDLKIPEEKLNIYGGAIALGHPIGASGARIIASLLN
ELKHENKHIGVASLCVGGGIGIAIILERA
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaagtagttataatagatgcagttagaacaccaattggaaaattcggtggtagt
ttgaaagacatcagtgcagtagatcttggtgctaccgctctaaaaggtgttttagaaaga
gccaatattgctccagaacgtgtggatcaagtaatttttggtaatgtattacaagctgga
cttggccaaaatgtagctagacaaatcgctattaaagcaggaattccttataaagtaccc
ggagtcacaatcaatgaagtgtgtggatctggcttaaaatcggttatgcttggcagacaa
gcaattcaactaggggaagctgacatcgtagcagtaggagggaccgaaaatatgtcccaa
gcaccacttttacttaatcccgagctagccggtgaagaaatcaatccaaaaaaactaaga
aatagcatgttaattgatggtttaacagatgtttacggcgaatatcacatgggaattact
gcagaaaatgttgcggaaaaattctccgtaacccgagaagaacaagatgaatttgctcat
aactctcaaatgaaggccgcaagtgcacaagaaaaaaaactttttgaagaagaaattatt
cctgtaaaacttccagacggttcattttttgaagccgatgaaacgattcgcgcgaattca
actctagaaaaattagctacgttgaaaagcgtattcaaagaaggtggaactgttacagcc
ggtaatgcttccggtatcaatgatggagcttccgcaattattttaatgtcgaaagaaaag
gcagtcgcggaaaacattccttatatcgcaacaatcaaagtaacctctgaggttggtgtc
gatccagcacttatgggttacgcgccatactatgcagtaaatgaagctttaactaaaggt
ggatattctatcgatgaaattgatttattccatttaaacgaagcttttgcatcgcagtct
gttgcagtggctcgtgatttgaaaattcccgaagagaaacttaatatttacggtggagca
attgcgctaggtcatccaatcggagcttccggcgcacgcattattgcctctttgttaaat
gaattaaaacatgaaaacaagcatatcggggtagcttccttgtgcgttggtggtggtatt
ggcattgcaattatccttgaaagagcatga

DBGET integrated database retrieval system