KEGG   Listeria monocytogenes J0161: LMOG_00908Help
Entry
LMOG_00908        CDS       T01987                                 

Definition
(GenBank) fructose-1,6-bisphosphatase
  KO
K04041  fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
lmj  Listeria monocytogenes J0161
Pathway
lmj00010  Glycolysis / Gluconeogenesis
lmj00030  Pentose phosphate pathway
lmj00051  Fructose and mannose metabolism
lmj00680  Methane metabolism
lmj01100  Metabolic pathways
lmj01110  Biosynthesis of secondary metabolites
lmj01120  Microbial metabolism in diverse environments
lmj01130  Biosynthesis of antibiotics
lmj01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:lmj00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LMOG_00908
   00030 Pentose phosphate pathway
    LMOG_00908
   00051 Fructose and mannose metabolism
    LMOG_00908
  Energy metabolism
   00680 Methane metabolism
    LMOG_00908
Enzymes [BR:lmj01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     LMOG_00908
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_2 Metallophos
Motif
Other DBs
NCBI-ProteinID: AEO02925
Position
complement(881759..883720)
Genome map
AA seq 653 aa AA seqDB search
MKTIDMKYLRLLAKEYPTIAKTATEIINLEAIMNLPKGTEHFLSDVHGEYSAFEQVLRNG
SGVVKRKIRDIFGAELDDAEINSLSTLIYYPEEKMDLIASETEDLHAWYRTTLFRLIELC
QYVASKYTRSKVRKAMPEDFAYILEELLHENYNEDDKKLYYEEILQHIISLGRAEEFISA
LSLLIQQLVVDHLHIVGDVYDRGPYPDKIMDTLMNYHSLDFQWGNHDILWMGAASGSRVC
AANVIRISARYLNLDILEDSYGISLRPLALFADEVYKDDPCTYFQPKNEENINYSNAEIT
QIARMHKAISIIQFKLEGEIINRRKEFDMNHRLLLQFIDYKKGTIQLKGKEYQLLDNHFP
TINPENPYELTDAERELIGKITAAFKNCRRLQKHVQFLYSKGSMFLTYNGNLLYHGCIPL
HEDGTFMEMKLRGEKYAGRALLEQFEILTREAYVRPTGTKEKKYACDIVWYLWTGAISSL
FGKSEMTTFERYFVAEKETHTEEKNPYYKLRNNELICKQILEEFELDGECGHIINGHTPV
KEGKGESPIKASGKMLVIDGGFAKAYHKETNLAGYTLLFNSYGLQLVSHQPFTTKEDAIK
NETDILSTRQVIEMEINRKRVRDTDIGAKLSEQAEDLKLLLDAYRNGLLHENR
NT seq 1962 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaactattgatatgaaatatttacgcttgttagcaaaagaatatcctactatcgcc
aagacagctacggaaatcattaacctcgaagcaattatgaaccttccaaaaggaacggaa
cattttttaagtgatgttcacggtgaatatagtgcttttgaacaagtgcttcgtaatggt
tctggtgttgtaaaacggaaaattcgtgatatttttggcgcagagctagatgatgcagag
attaattcacttagtacactgatttattatccagaagaaaagatggatttgattgctagt
gaaacagaagatttgcatgcttggtatcgcaccacactttttcgtttgattgaactctgc
cagtatgttgcttcaaaatacacacgttctaaagttagaaaagccatgccagaagatttt
gcctacatattagaagagttacttcatgaaaactacaatgaagacgataaaaagctttat
tatgaagaaattttacaacatattatttcacttggtcgtgcagaagaatttattagcgct
ctctcgctacttattcaacaattggtcgtggatcatttgcacattgttggtgatgtttat
gatcgtggcccttatccagataaaatcatggatacattaatgaattaccattcgctcgat
ttccagtggggtaatcacgatattttatggatgggcgcggctagtggctctagggtttgt
gcggctaatgttattcggatttctgctcgctatttaaatttagatattttagaagatagt
tacggtatttcccttcgccccctagccctttttgccgacgaagtgtacaaagatgatcct
tgtacctacttccagccaaagaatgaagaaaatatcaactatagtaatgctgaaatcacg
caaattgctaggatgcacaaggctatctcgattattcagtttaaattggaaggtgaaatt
attaaccgacgcaaagaatttgatatgaatcatcggcttttacttcaatttatcgattac
aaaaaaggcacaattcaactaaaaggaaaagaataccagttgttagacaatcattttcca
acgattaatccagaaaatccttatgaacttactgatgcggagagagaacttattgggaaa
attactgccgcttttaaaaactgccgccgattgcaaaaacatgtacaatttctatattca
aaaggcagcatgtttttaacttataatggcaatttactctaccatggctgcattccgctc
cacgaagatgggacttttatggaaatgaaattacgtggcgaaaaatatgctggtcgtgcg
cttttagagcagtttgaaatacttacccgcgaagcatacgtccgcccaactggaacaaaa
gaaaagaaatatgcgtgtgatatcgtttggtatttgtggactggtgccatttcttcgcta
ttcggaaaaagtgaaatgactacgtttgaacgttattttgttgcagaaaaagaaacccac
acagaggaaaaaaatccttattataaattgcgtaataacgaattaatttgcaaacaaatt
ttagaagaatttgagcttgacggagaatgcgggcatatcattaacggccatacgccagtc
aaagaaggaaaaggtgaaagtccgattaaagcgagtggtaaaatgctcgtcatcgatggc
gggttcgcaaaagcatatcataaagagacaaacttagcgggttatacactacttttcaac
agttacggtttacaactagttagtcatcagccatttactacaaaagaggatgctatcaaa
aatgaaacggatattctttccacgcgtcaagttatcgaaatggaaattaaccgtaaacgt
gtaagggataccgatattggggctaaacttagtgaacaggcagaagatttaaaattgcta
ctagatgcttatcgtaatggtttgcttcatgaaaaccgttaa

DBGET integrated database retrieval system