KEGG   Listeria monocytogenes J0161: LMOG_01257Help
Entry
LMOG_01257        CDS       T01987                                 

Definition
(GenBank) glucose-6-phosphate dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
lmj  Listeria monocytogenes J0161
Pathway
lmj00030  Pentose phosphate pathway
lmj00480  Glutathione metabolism
lmj01100  Metabolic pathways
lmj01110  Biosynthesis of secondary metabolites
lmj01120  Microbial metabolism in diverse environments
lmj01200  Carbon metabolism
Module
lmj_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
lmj_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:lmj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    LMOG_01257
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    LMOG_01257
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lmj04147]
    LMOG_01257
Enzymes [BR:lmj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     LMOG_01257
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     LMOG_01257
Exosome [BR:lmj04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   LMOG_01257
  Exosomal proteins of colorectal cancer cells
   LMOG_01257
  Exosomal proteins of bladder cancer cells
   LMOG_01257
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-ProteinID: AEO04062
Position
2049322..2050797
Genome map
AA seq 491 aa AA seqDB search
MTDELEQKALITIFGGTGDLANRKLYPSLYHLYSKGSLGDNFAVIGTARREWSNDFFRDK
VKESIKDIDGSEKDADAFASHFYYQSHDVTNKESYLTLKDLSDELDAKYELDGNRLFYLA
MAPNFFGTIASRIKSEGFVDTDGFHRLIIEKPFGHDLASAEELNNSLRQAFKEDEIYRID
HYLGKEMIQNISVIRFANSIIESLWNNRYIDNIQVTLTEVLGVEDRGRYYDESGALRDMV
QNHILQIVSLLAMEPPINLSTREIRHEKVRALRSLRVFEGKEVHQSFIRGQYGPGEVDGK
ELKGYRQEDNVDPHSNTETFVAAKLEIDNFRWAGVPFYIRTGKRLAKKTTQIAIQFKDVP
LNLFGQQQSLGGNVLVIHIQPDEGITLHLNVKEPGQGMVTMPVNLNYIHSSPDGMNTPEA
YEKLILDCLRGDATYFSHWDEVSLSWNFIDHIADVWTNTKDHFPNYKSGSMGPKEADDLI
QRDGFQWFPID
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgacagatgagttagaacaaaaagcactgattactatttttggcggtacgggagatttg
gcaaatcgcaaactttacccttcgctatatcatttgtacagtaagggatctcttggcgac
aattttgctgttattggaacggctcgtcgtgaatggagtaacgatttcttccgtgataaa
gtaaaagagtctatcaaagacattgacggttctgaaaaagacgcagatgcatttgcttct
cacttctactatcaatctcatgatgtgacaaataaagaatcttatctaactttaaaagat
ttgtctgatgaattagatgcaaaatacgaattagatggcaatcgccttttctatcttgca
atggctccaaatttctttggaactatcgcaagtcgcattaaatctgaaggctttgttgat
acagacggtttccatcgtttaattatcgaaaaaccattcggccatgatttagctagtgcg
gaagaattaaacaattcacttcgtcaagctttcaaggaagatgaaatttatcgtattgac
cattatttaggaaaagaaatgatccaaaatatttcggttattcgttttgcaaattctatt
attgaatcgctttggaataatcgttacatcgataatattcaagttactttaacagaggta
cttggagtcgaagatcgtggacgctattacgatgaaagtggcgcacttcgagacatggtt
caaaatcatatcttacaaatcgtttctttacttgcaatggagccaccgattaacttatct
actcgcgagattcgtcatgaaaaagttcgcgcgcttcgttctttacgcgtttttgaagga
aaagaagtgcatcaaagctttatccgtggtcaatatggtcccggtgaagtggatggtaaa
gagttaaaaggttatcgtcaagaagataatgtggatccccattccaatacggaaacattt
gttgcagccaaacttgaaatcgataatttccgctgggctggcgtaccattttacattcgc
actggtaaacgtcttgcgaagaaaacaacgcaaattgcgattcagtttaaagatgtccca
ctaaacttattcgggcaacaacaatcacttggtggtaatgtgcttgttattcatatccaa
ccggacgaaggtattacacttcatttgaacgtaaaagaacctggtcaaggtatggttacg
atgccagtcaacttgaattatattcattcctctccagacggcatgaacacacctgaggct
tacgaaaaattgattctagactgtcttcgcggtgacgcgacttacttctctcactgggat
gaagtatcgctatcatggaactttatcgaccatatagcagatgtttggacaaatacgaaa
gatcatttcccgaactacaaatccggttcaatggggccaaaagaagcagacgacctcatt
caacgcgacggattccagtggttcccgatcgattaa

DBGET integrated database retrieval system