KEGG   Listeria monocytogenes J0161: LMOG_02388Help
Entry
LMOG_02388        CDS       T01987                                 

Definition
(GenBank) aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
lmj  Listeria monocytogenes J0161
Pathway
lmj00010  Glycolysis / Gluconeogenesis
lmj00052  Galactose metabolism
lmj01100  Metabolic pathways
lmj01110  Biosynthesis of secondary metabolites
lmj01120  Microbial metabolism in diverse environments
lmj01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:lmj00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LMOG_02388
   00052 Galactose metabolism
    LMOG_02388
Enzymes [BR:lmj01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     LMOG_02388
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: AEO04574
Position
complement(2560510..2561553)
Genome map
AA seq 347 aa AA seqDB search
MKERFGEFEGETVWKWTMINDHDMRMSVLNYGAIVTSLETKDKFGDFANISLGFTNLDDY
LAHSPYFGATLGPVAGRITNGQFSLDGKQFQLIQNEGSNHRHGGKFNFSKKLWDVSVEKS
LDQIVMTFEYCWADGENGYPGKIDAKMTYTLNNKNEWLVDYEARSNQPTIYNPSNHIYFN
LSGEAGSTVLQHQLWVNSDSFLPIDEEFLPIGEKRLAENTIFDLRAGREVAEITQSQDQQ
VKLVGAGLDHTFILKHENGRPDAVLFDPKSGRRLEMETKADSVLIYTANSLDGSFEIDER
AVPKYAGITMETQGLVDAINHDGFGDIVLRPEKPFTSRTAFRFTVES
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgaaggagcgatttggggagtttgaaggagaaactgtttggaagtggacgatgataaat
gatcatgatatgcgcatgagtgttttaaattacggagcgattgttacttcacttgaaaca
aaagataaatttggtgattttgcgaatattagtcttggttttacaaatttagatgattat
ttggcacactctccttacttcggcgcgacacttggccctgttgctggacgtattacaaat
gggcaatttagtttggatggcaaacaatttcaactgattcaaaatgaaggctctaaccat
cgtcacggtgggaaattcaattttagtaagaagctttgggatgtttcagtagaaaaaagt
cttgatcaaattgtgatgacttttgaatactgctgggcggatggagaaaatggctatcca
ggaaaaattgatgcaaaaatgacatatacgttaaataataaaaatgaatggctggttgat
tatgaagcgagaagcaatcagccgactatatataacccgagcaatcatatttattttaat
ctgagcggagaagctggttcaacggttttacaacatcagctttgggtcaatagtgatagc
ttcctaccaattgatgaagagttcctcccaattggggaaaagcggttagcggaaaatact
atctttgatttgcgtgcaggtcgtgaagtagcggagattacacaaagtcaggaccagcaa
gtaaaattagttggtgcggggctggatcatacgttcattttaaaacatgaaaatggtcgt
ccagatgcagttttgtttgatccaaagtcaggacggcgcttggaaatggaaaccaaagct
gactcggtattaatttatacggcgaatagtttggatggctcttttgagattgacgagcga
gctgtaccaaaatatgctggcataacaatggaaacacagggtttggtggatgcgattaac
catgacggatttggtgatattgtacttcgaccagaaaaaccttttacatctagaacagct
tttcgtttcacagtggagagctga

DBGET integrated database retrieval system