KEGG   Listeria monocytogenes L99 (serotype 4a): lmo4a_0193Help
Entry
lmo4a_0193        CDS       T01989                                 

Gene name
metS
Definition
(GenBank) Methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
lml  Listeria monocytogenes L99 (serotype 4a)
Pathway
lml00450  Selenocompound metabolism
lml00970  Aminoacyl-tRNA biosynthesis
lml01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lml00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    lmo4a_0193 (metS)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    lmo4a_0193 (metS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:lml01007]
    lmo4a_0193 (metS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:lml03016]
    lmo4a_0193 (metS)
Enzymes [BR:lml01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     lmo4a_0193 (metS)
Amino acid related enzymes [BR:lml01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   lmo4a_0193 (metS)
Transfer RNA biogenesis [BR:lml03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    lmo4a_0193 (metS)
 Prokaryotic type
   Other AARSs
    lmo4a_0193 (metS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA_bind tRNA-synt_1e Anticodon_1 tRNA-synt_1f ARL2_Bind_BART DUF2724
Motif
Other DBs
NCBI-ProteinID: CAR82895
Position
194983..196980
Genome map
AA seq 665 aa AA seqDB search
MLPEEKNTFYITTPIYYPSGKAHIGHAYTTVAGDAMARYKRLKGYDVFYLTGTDEHGQKI
QAKAKERGISEQEYVDEIAEGFQELWKKLEISNTDFIRTTQDRHKTSVEKIFEQLLEQGD
IYLGEYEGWYSVSDEEYFTETQLEEVYKDENGKVIGGKAPSGNEVELVKEESYFFRMSKY
ADRLVEYYNSHPEFILPESRKNEMINNFIKPGLEDLAVSRTTFDWGIKVPGNPKHVVYVW
IDALSNYITALGYNTDNDTKFQKYWPADVQIVGKEIVRFHTIYWPIMLMALDLPLPKMVF
GHGWILMKDGKMSKSKGNVVDPYMLIDRYGLDALRYYLLREVPFGSDGLFTPEDFVDRVN
YDLANDLGNLLNRTVAMINKYFDGEIPAYQGNVTEFDQTLVDFKNNVVKEYEASMEHMQF
SVALNQLWSLVSRTNKYIDETAPWALAKEEEKRAELASVMTHLAENLRIIAVLLQPFLTR
TPGEIFLQLGLQEENLKKWDSIYGYGEIPAGTTVVKKGTPIFPRLDAEVEVTYIQDEMKG
SAPAPAEEVAEVEALETPQIGIEDFDKIDLRVAEVKQVDKVKKADKLLCFQLDLGEGKLR
QVLSGIAEFYQPEELIGKKVIVVSNLKPVKLRGLMSEGMILSGEKDGKLSVIEASSALPN
GAKVK
NT seq 1998 nt NT seq  +upstreamnt  +downstreamnt
gtgttgcctgaagagaaaaatacgttttatattaccacaccaatctattatccaagcgga
aaagcgcatatcggccatgcttatacgactgttgcgggggacgcgatggctcgttataaa
cgcttaaaaggatatgatgtgttttacttaactggaacagatgagcacggtcaaaaaatc
caagcaaaagcgaaagaacgcggaatttctgaacaagaatacgtggatgaaatcgcagaa
ggtttccaagaactttggaaaaaactagaaatttctaatacggattttattcgtacaaca
caagaccgtcataaaacatcagttgaaaaaatctttgaacaacttttagagcaaggcgac
atttacttaggtgaatacgaaggttggtactctgtttctgatgaagaatactttacagaa
acacagttagaagaagtatataaagatgaaaatggtaaagtaatcggcggaaaagcccca
agtggcaatgaagtcgaacttgttaaagaagaatcctacttcttccgtatgagtaaatat
gcggaccgtttagtagaatattataattcccatccagaatttatccttcctgaatctaga
aaaaatgaaatgattaataatttcatcaaacctggtttggaagatttagctgtatctaga
acaacttttgattggggtattaaagttcctggcaatccaaaacatgtcgtttatgtatgg
attgatgcgctttctaactatattactgcgcttggatataatacggacaatgacacgaaa
ttccaaaaatactggcctgctgatgtgcaaattgttgggaaagaaattgttcgtttccat
acaatttattggccaattatgttgatggcgctagacttaccacttccaaaaatggtgttt
ggccacggctggattctaatgaaagacggtaaaatgtcgaaatccaaaggtaacgtagta
gatccttacatgctgattgaccgttacggcctagacgcgcttcgttattacttactacgt
gaagttccatttggctcagatggtttatttacaccagaagattttgttgaccgtgtaaac
tatgaccttgccaacgatttaggaaacttacttaatcgtacagtagcaatgattaataaa
tactttgatggcgaaatcccagcttatcaaggcaatgtcactgaatttgaccaaacatta
gtagatttcaaaaacaatgtagtgaaggaatacgaagctagcatggagcacatgcaattt
tctgtagccctaaaccaactttggtcacttgtttctcgcacaaataaatatatcgacgaa
actgctccgtgggcacttgccaaagaggaagaaaaacgtgcagaacttgcgagcgtaatg
actcatttagcagagaatttacgtattatcgcggtacttttgcaaccattcttgacaaga
actccaggagaaatcttcttacaactaggtttacaagaagaaaacttgaaaaaatgggat
agcatttacggatacggtgaaattccagcaggcacaacggtggtgaaaaaaggtacgcca
attttcccaagacttgatgcggaagtggaagttacttatattcaagatgaaatgaaaggc
tctgcgccagctcctgccgaagaagtggcggaagtagaagcgcttgaaactccgcaaatc
ggcattgaagatttcgacaaaatcgatcttcgcgttgcagaagtaaaacaagtagataaa
gtgaaaaaagcagataaacttctttgcttccaattagacttaggggaaggaaaactgcgc
caagtgctttcgggcattgcagaattctatcaaccagaagagttaattggcaaaaaagta
atcgtcgtttctaacttaaaacctgtaaaacttcgcggattaatgagtgaaggcatgatt
ctttcaggcgaaaaagatggcaaactaagtgtaattgaagcaagtagcgcacttccaaac
ggtgcaaaagtaaaataa

DBGET integrated database retrieval system