KEGG   Listeria monocytogenes L99 (serotype 4a): lmo4a_1472Help
Entry
lmo4a_1472        CDS       T01989                                 

Definition
(GenBank) unnamed protein product; Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
lml  Listeria monocytogenes L99 (serotype 4a)
Pathway
lml00071  Fatty acid degradation
lml00072  Synthesis and degradation of ketone bodies
lml00280  Valine, leucine and isoleucine degradation
lml00310  Lysine degradation
lml00362  Benzoate degradation
lml00380  Tryptophan metabolism
lml00620  Pyruvate metabolism
lml00630  Glyoxylate and dicarboxylate metabolism
lml00640  Propanoate metabolism
lml00650  Butanoate metabolism
lml00900  Terpenoid backbone biosynthesis
lml01100  Metabolic pathways
lml01110  Biosynthesis of secondary metabolites
lml01120  Microbial metabolism in diverse environments
lml01130  Biosynthesis of antibiotics
lml01200  Carbon metabolism
lml01212  Fatty acid metabolism
lml02020  Two-component system
Brite
KEGG Orthology (KO) [BR:lml00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    lmo4a_1472
   00630 Glyoxylate and dicarboxylate metabolism
    lmo4a_1472
   00640 Propanoate metabolism
    lmo4a_1472
   00650 Butanoate metabolism
    lmo4a_1472
  09103 Lipid metabolism
   00071 Fatty acid degradation
    lmo4a_1472
   00072 Synthesis and degradation of ketone bodies
    lmo4a_1472
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    lmo4a_1472
   00310 Lysine degradation
    lmo4a_1472
   00380 Tryptophan metabolism
    lmo4a_1472
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    lmo4a_1472
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    lmo4a_1472
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    lmo4a_1472
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lml04147]
    lmo4a_1472
Enzymes [BR:lml01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     lmo4a_1472
Exosome [BR:lml04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   lmo4a_1472
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: CAR84176
Position
complement(1461137..1462306)
Genome map
AA seq 389 aa AA seqDB search
MNEVVIIDAVRTPIGKFGGSLKDISAVELGATALKGVLERANIAPDRVDQVIFGNVLQAG
LGQNVARQVAIKAGIPYKVPGVTINEVCGSGLKSIMLGRQAIQLGEADIVAVGGTENMSQ
APLLLNPELAGEEIDPKNLRNSMLIDGLTDVYGDYHMGITAENVAEKFSVTREEQDKFAH
NSQMKAASAQEKNLFEEEIIPVKLADGSFFEADETIRANSTLEKLATLKSVFKEDGTVTA
GNASGINDGASALILMSKEKAIAENIPFIATIKVTSEVGVDPAYMGYAPYYAVNEALTKG
GYSIDDIDLFHLNEAFASQSVAVARDLKIPEDKLNIYGGAIALGHPIGASGARIIASLLN
ELKHENKHLGVASLCIGGGIGIAIIVERA
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaagtagttataatagatgcagttagaacaccaattggaaaattcggtggcagt
ttgaaagacatcagtgcagtagaacttggcgctaccgctctaaaaggcgtattagaaaga
gccaacattgctccagaccgcgtagatcaagttatttttggtaacgttttacaagcaggt
ctcggtcaaaacgtagctagacaagtcgctattaaagcaggaattccttataaagtacct
ggagtcacaatcaatgaagtttgtggatctggtttaaaatcgattatgcttggaagacaa
gcgatccaattaggcgaggccgacattgtagcagtgggagggaccgaaaacatgtctcaa
gcaccactattacttaatccggaactagccggcgaagaaattgatcccaaaaacttaaga
aatagcatgttaattgatggtttaacggatgtgtacggcgattatcatatgggaattaca
gccgaaaatgtggcagaaaaattctctgtaacccgagaagagcaagataaatttgcacat
aactcccaaatgaaagcagcaagtgcacaagaaaaaaacctttttgaagaagaaattatt
ccagtgaaacttgcagatggttcgtttttcgaagccgatgaaacgattcgtgcgaattcc
actttagaaaaactagctacattaaaaagcgtatttaaagaagatggaacagtcacagct
ggtaatgcttccgggatcaatgacggagcttctgcgcttattttaatgtcgaaggaaaag
gccattgccgaaaatattccttttatcgcgacaatcaaagtaacttcagaagttggtgtt
gatccagcatatatgggttacgcgccttactatgcagtaaatgaagcattaactaaaggc
ggatattctatcgatgacattgatctatttcatttaaatgaagcttttgcatcacagtcg
gttgccgtagctcgtgatttgaaaattccagaagataaactgaatatttacggcggagca
attgcgttaggtcatccaatcggagcatccggagcacgcattattgcctccttattaaat
gagttaaaacacgaaaataaacatcttggcgtggcttccttatgtatcggcggcggtatt
ggaattgcaattattgtcgaaagagcttga

DBGET integrated database retrieval system