KEGG   Listeria monocytogenes L99: lmo4a_1687Help
Entry
lmo4a_1687        CDS       T01989                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
lml  Listeria monocytogenes L99
Pathway
lml00260  Glycine, serine and threonine metabolism
lml00400  Phenylalanine, tyrosine and tryptophan biosynthesis
lml01100  Metabolic pathways
lml01110  Biosynthesis of secondary metabolites
lml01130  Biosynthesis of antibiotics
lml01230  Biosynthesis of amino acids
Module
lml_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:lml00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    lmo4a_1687 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    lmo4a_1687 (trpA)
Enzymes [BR:lml01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     lmo4a_1687 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA BtpA His_biosynth
Motif
Other DBs
NCBI-ProteinID: CAR84391
Position
complement(1689091..1689864)
Genome map
AA seq 257 aa AA seqDB search
MTKTLTNKLAKKDHAAVVTYIMGGDGGLDNLEEQLLFLEKSGVSAIEIGIPFSDPVADGP
IIQLAGLRALKEQVSLEAILNKLARSKVQIPLIIMSYINPIFHLGIPKFVELVQKTPVKG
LIIPDLPYEHQTLITPELQGTDIALIPLVSLTSPKERLEEIAKQAEGFIYAVTVNGTTGV
RSEFDAHIDNHLAYLKSISPVPVLAGFGVSSIEHVEKFAHVCDGVIIGSKVVQMLHEEKT
AELGAFLQKAAEVRIEN
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgactaaaacattaacgaataaactagcgaaaaaagatcatgcagccgtagttacttac
attatgggtggcgatggtggcttagataatttagaagaacagttattgtttctagaaaaa
tctggtgtaagcgcgattgaaattggtattcctttttctgatccggttgccgacggtccg
attattcaacttgctgggttacgtgctttaaaggagcaagtgagtttagaagccatttta
aataaattggctaggagtaaagtacaaattccgttaattattatgagttatattaatccg
atttttcatttaggcatcccgaaatttgttgaattggtgcagaaaacgccggtgaaaggg
cttattattcctgatttaccttatgagcaccaaacactgattacaccagaacttcaaggg
acagatatcgcacttattccgcttgtttcattgacaagtccgaaagagcgcctcgaagaa
attgcgaaacaggcagaagggtttatttatgcagtaacagttaacggaactaccggtgtg
aggagtgaatttgatgcccatattgataaccatttagcttatttgaaaagcattagccct
gttccagttctcgcaggttttggtgtttcttctattgaacatgtggaaaaatttgcgcac
gtatgtgatggtgtaataatcggtagtaaagtcgtgcaaatgttacatgaagaaaaaacg
gcagagctaggagcgtttttacaaaaggccgcagaagttcgaatcgaaaactaa

DBGET integrated database retrieval system