KEGG   Listeria monocytogenes L99 (serotype 4a): lmo4a_2152Help
Entry
lmo4a_2152        CDS       T01989                                 

Definition
(GenBank) class II aldolase/adducin domain protein
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
lml  Listeria monocytogenes L99 (serotype 4a)
Pathway
lml00051  Fructose and mannose metabolism
lml01100  Metabolic pathways
lml01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:lml00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    lmo4a_2152
Enzymes [BR:lml01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     lmo4a_2152
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II
Motif
Other DBs
NCBI-ProteinID: CAR84856
Position
complement(2190091..2190741)
Genome map
AA seq 216 aa AA seqDB search
MLYQKEREDLAKVVKTMFDRFETNAAGGNVSVRMNNEHIIMTPTLMSQAKLCDLSPYEIL
VVDNNNEVVEGDGRVTREINLHRACYVENPKIGCVLHAHPKESMLFATLGMELPNLTEAT
QKIGQIPTLEFAPATSPELAEIVRKHVIELGEKAVPSASLLNKHGIVVLDTSLHKAYDML
ERIEYNAYIAEKALVFDALGIKKLAHDRELNYNLEE
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgttataccaaaaagaacgtgaagatttagcaaaagtagtgaagacgatgtttgaccgc
tttgaaacgaatgcggctggaggaaatgttagtgtgcgcatgaataatgagcatattatt
atgacgccaacgctgatgagtcaagcaaaactttgcgatctttccccatatgaaatcctt
gtagtggataataacaatgaagtcgtagaaggagacggaagagttactagagaaattaac
ttacaccgcgcttgttacgtagaaaatccaaaaatcggctgtgtactccatgctcatcca
aaagaatccatgctatttgccacacttgggatggaattaccgaatttaacagaagcaacg
caaaaaattggacaaattccaacacttgaatttgcgccagcgactagtccagaacttgcg
gaaatcgttcgtaaacacgttatcgaactaggggaaaaagctgttcctagtgcaagttta
ttaaataaacacggtattgtcgtattagatacatcgcttcataaagcatacgacatgcta
gagcgtattgaatacaatgcctatattgcagaaaaagcgttagtatttgatgctttaggt
attaaaaaattagctcatgaccgcgaattaaattataatttggaggagtaa

DBGET integrated database retrieval system