KEGG   Leuconostoc mesenteroides subsp. mesenteroides J18: MI1_01215Help
Entry
MI1_01215         CDS       T01768                                 

Definition
(GenBank) gamma-glutamyl kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
lmm  Leuconostoc mesenteroides subsp. mesenteroides J18
Pathway
lmm00330  Arginine and proline metabolism
lmm00332  Carbapenem biosynthesis
lmm01100  Metabolic pathways
lmm01130  Biosynthesis of antibiotics
lmm01230  Biosynthesis of amino acids
Module
lmm_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:lmm00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    MI1_01215
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    MI1_01215
Enzymes [BR:lmm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     MI1_01215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase
Motif
Other DBs
NCBI-ProteinID: AET29705
Position
243868..244656
Genome map
AA seq 262 aa AA seqDB search
MNSWHRIVVKVGTSTIVNRDGQINYPVVNRLAQTLSSLQKSGHEILLVTSGAIGVALDQM
NLEKRPQEIPQQQALAAIGQGYLMSLYNQSFAFYQQLIGQVLLTYDVFDNKAMLENTMNA
IEMMFSQHIIPIVNENDVIAVDELDHQHSFGDNDRLAAIVTREIGADGLIILSDVDALYT
ANPNIDEFAQAIDKVTKITDDIRMSATGSTSGLGTGGMSTKLAAGEFVMKNGGKMVLING
NNPALILEVIAGKTVGTLFQGE
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgaatagttggcatagaattgttgttaaagtcggcacgagcacaattgttaatcgtgat
gggcaaattaattacccagtcgttaatcggttggcacaaacactttccagtttacaaaaa
tctggtcacgaaattttattagttacatccggggcaattggtgtggcattggatcagatg
aatctagaaaaacgaccacaagaaattccacaacagcaagcattagctgccattggtcag
ggatacttgatgtcattgtacaatcaaagttttgcattctatcaacaattaattggacaa
gttttattgacgtatgatgtgttcgacaataaagcgatgcttgaaaacacaatgaatgcc
attgaaatgatgttttcacagcacatcattcccattgttaatgaaaatgatgtgattgca
gttgatgagcttgaccatcaacattcatttggcgataatgaccgcttagctgctattgtg
acacgtgaaattggtgccgatggattaattattttgagcgatgtcgacgcgttgtatacg
gctaatcctaatattgatgaatttgcacaagccattgataaggtaacgaaaattaccgat
gatattcgtatgagcgccaccggatcaacttctggtttaggaacaggtgggatgagcaca
aaacttgctgctggtgaatttgtgatgaaaaatggtggtaaaatggtgttaattaatggt
aataatccagccttgattttagaagtaatagctggtaaaacggtgggaacattatttcaa
ggagaatga

DBGET integrated database retrieval system