KEGG   Leuconostoc mesenteroides subsp. mesenteroides J18: MI1_03385Help
Entry
MI1_03385         CDS       T01768                                 

Definition
(GenBank) dienelactone hydrolase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
lmm  Leuconostoc mesenteroides subsp. mesenteroides J18
Pathway
lmm00010  Glycolysis / Gluconeogenesis
lmm00020  Citrate cycle (TCA cycle)
lmm00620  Pyruvate metabolism
lmm01100  Metabolic pathways
lmm01110  Biosynthesis of secondary metabolites
lmm01120  Microbial metabolism in diverse environments
lmm01130  Biosynthesis of antibiotics
lmm01200  Carbon metabolism
Module
lmm_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:lmm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MI1_03385
   00020 Citrate cycle (TCA cycle)
    MI1_03385
   00620 Pyruvate metabolism
    MI1_03385
Enzymes [BR:lmm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     MI1_03385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 PTS_EIIA_1 RnfC_N
Motif
Other DBs
NCBI-ProteinID: AET30137
Position
710045..711340
Genome map
AA seq 431 aa AA seqDB search
MTEIFKMPDIGEGMAEGDITSWLVKVGDTIAADDPVAEVQNDKLMQEILSPYGGKVTKLF
VDAGTTVEVGDPLIEFDGDGSSENDSDNGHVAQPSISSNVVETEQSTPKNTAPKETSTVQ
VANGHVLAMPSVRHLAHEKNIDLTQVPATGRHGHVTLADVENFQGSDNSAPTQTQTSTTS
QTESSAAVHEEPAPALPLREGRQPMAPVRKAIARAMDRQAAIPTVTNFDSVDVRKLVCHR
KAFKEMARDDKGIRLTYLAYAVKALAAVAKKFPELNASVDMKAQEIVYHDDVNMGIAVDA
PAGLFVPVIKNADRKSIFTIAQEITDLAEAVRDGSITPAQMQGGTITISNLGSARGTWFT
PIINGKEVAILGLGSILKEPIVNDDGELAVGQNMKLSLTYDHRLIDGMLGQSALNYLKQL
LSDPAYMLMEV
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgactgagatttttaagatgccagatattggcgaaggtatggcggagggagatattact
tcttggctggttaaagttggtgatacgatagcggctgatgatccagtcgcagaagtacaa
aatgataaattgatgcaagaaattttgtctccgtatggtggcaaagttacaaaacttttt
gttgatgccggaacaacagttgaggttggcgatccattaattgagtttgatggagacggc
agcagtgaaaatgactctgataacggtcatgtagcgcaaccaagtatttcttcgaacgta
gtggagacagagcaaagcaccccaaaaaacacagctcctaaggaaactagcactgttcaa
gtagcaaacggtcatgtgctggcaatgccatcagtacgtcatttggctcatgagaaaaat
atagatttaacacaagtaccagctactggtcgccatggtcatgttacattagcagacgtt
gaaaatttccagggatcagacaattcagcacccactcaaacgcaaacatcaaccacatct
caaacagagtcgtctgcagctgttcatgaggaaccagcaccagcattaccattgcgtgaa
gggcgtcaaccaatggcaccagtacgtaaagcgatagctagagcgatggataggcaagca
gctattccaacagtaacgaattttgattctgttgatgttagaaaattggtttgccaccgt
aaggcgtttaaggaaatggctcgagatgacaaaggcatacgtttaacatatctagcctat
gctgttaaagcgttggcagctgtagctaagaaattcccagaattaaatgctagtgttgac
atgaaggcgcaagaaattgtttatcacgatgatgttaacatgggtatcgctgtggatgcg
ccagctgggttgtttgtgccagtcattaagaatgcagatcgaaagtctattttcacaatt
gcgcaagaaataactgatcttgctgaagcagttcgtgatggatcaattacacctgcccaa
atgcagggcggaacaatcacaatttctaaccttggttcggcccgaggtacttggtttaca
ccaattattaacggtaaagaagtagcaatattgggattaggttcgatcttaaaggaaccg
attgtcaatgacgatggagagctagccgtgggccaaaacatgaaattatcattgacctat
gatcatcgtttgattgatggcatgctagggcaatcggcccttaattatttgaagcagcta
ttgtctgacccagcctatatgttgatggaggtgtaa

DBGET integrated database retrieval system