KEGG   Leuconostoc mesenteroides subsp. mesenteroides J18: MI1_04285Help
Entry
MI1_04285         CDS       T01768                                 

Definition
(GenBank) butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
lmm  Leuconostoc mesenteroides subsp. mesenteroides J18
Pathway
lmm00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:lmm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    MI1_04285
Enzymes [BR:lmm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     MI1_04285
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     MI1_04285
    1.1.1.-  
     MI1_04285
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N ADH_zinc_N_2 ADH_N_assoc Glu_dehyd_C Pyr_redox_2 2-Hacid_dh_C PrmA TrkA_N FtsJ UDPG_MGDP_dh_N Pyr_redox_3 Titin_Z AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: AET30313
Position
916222..917271
Genome map
AA seq 349 aa AA seqDB search
MKAAVWHGVKDVRVEDVELKPTKSNEVVVRVAYAGICGSDLHEYLEGPVFIPVDQPDELT
GGQAPLTMGHEFSGVIEKVGPDVANFKVGDHVSINPTVTKGISSDDLDVYDGYSFIGLST
DGGFTSYVNVPEDNLYHLPEEFSLKLAATIEPTAVAVQAIKEADLRFGEKVVIFGAGPIG
VLVAAAAKAAGATKIVAVDLSEVRLRKALEMGATDVINPSQVPDTIAAIKNIIPGGADAS
FEVAGVQPTFEQAIDATRPRGSVVIVSIFAKPISFNPMQLMNAGVKLTTTIAYSKETFQQ
TVALVSSGQINVEPVITDTISLDSIVSDGFESLTSDKSQAKILIDLSKD
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagctgtatggcatggcgttaaagatgttcgtgtggaggatgttgaactcaaa
ccaacaaaatctaatgaggtagtagtgcgtgttgcttatgctgggatttgtggcagcgac
ttacacgagtaccttgagggccctgtatttattcccgttgatcaaccagatgaattgact
ggcggtcaagcaccattaacgatgggacatgagttttctggcgttatcgaaaaagtaggt
cctgatgtggctaattttaaagttggggatcacgtttcaattaatccaactgtcacaaag
ggaatttcttctgatgatttggatgtttacgatggctatagctttattggtttaagcacg
gatggtggctttacatcatacgtgaatgtaccagaagataacttatatcatttacctgaa
gaattctcattgaaattagcagctactattgagccaactgcagttgcggtccaagctatc
aaagaggctgatcttcgatttggcgaaaaagttgtgatttttggtgctggaccaataggt
gtattagttgctgctgctgcgaaggcagcaggggctactaaaatcgtggctgtagatttg
tcagaagttcgcttgagaaaagcgcttgaaatgggcgcaacagacgtgattaatccaagt
caagtgccagacactattgcagctattaagaacattattcctggtggagcggatgcatca
tttgaagttgccggggtacaaccaacctttgaacaagcaatagatgcaacacgtccgcgc
ggaagtgtcgttattgtttcaatttttgcaaagccaatcagctttaacccaatgcaattg
atgaatgcaggtgttaaactgaccacaacaattgcttattcaaaagaaactttccaacaa
actgttgctcttgttagcagtgggcaaataaatgtagaaccagttattacggatacaatt
tcattggacagtattgtttctgatggttttgagtcattaacaagcgataaatcgcaggcc
aagattttaattgatttaagtaaagattaa

DBGET integrated database retrieval system