KEGG   Leuconostoc mesenteroides subsp. mesenteroides J18: MI1_05590Help
Entry
MI1_05590         CDS       T01768                                 

Definition
(GenBank) acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
lmm  Leuconostoc mesenteroides subsp. mesenteroides J18
Pathway
lmm00430  Taurine and hypotaurine metabolism
lmm00620  Pyruvate metabolism
lmm00640  Propanoate metabolism
lmm00680  Methane metabolism
lmm01100  Metabolic pathways
lmm01120  Microbial metabolism in diverse environments
lmm01200  Carbon metabolism
Module
lmm_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:lmm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    MI1_05590
   00640 Propanoate metabolism
    MI1_05590
  09102 Energy metabolism
   00680 Methane metabolism
    MI1_05590
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    MI1_05590
Enzymes [BR:lmm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     MI1_05590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase
Motif
Other DBs
NCBI-ProteinID: AET30562
Position
complement(1164073..1165329)
Genome map
AA seq 418 aa AA seqDB search
MSKIMAVNAGSSSLKFQLLEMPEETVITQGVIERIGMDDAIITVKYGADVEPVRLVGTED
GTISLTKSGDQKYEAELPIKDHHAAIDLMLKKLSDLGIIKDFQEITGVGHRVVAGGEWFN
HSVVVDDDVLSKIDRLADYAPLHNPANAMGIRAFQKLLPHATSVAVFDTSFHQTMPEKNY
LYSLPYEYYARYGARKYGAHGTSHRYVTERAADKLGIPLDEFNAISFHLGAGASVTAIKN
GKSYDTSMGFTPLAGLTMATRSGDVDPSLIYYIQEREGLSNEEMLNVLNKKSGLLGISTI
SSDMRDLENVQETNTHAQLALDMFYDRVIRYAGQYFAELGRVDAIIFTAGIGENDALTRA
KVLKSLAFAGVDLDEEANNVRGKETIITTSGSKVTGLLIPTNEELMIARDVVTLQNTK
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaaataatggcagtaaacgccggaagttcttcacttaagtttcaattgttagaa
atgcccgaggaaacagttattacacaaggggtaatcgaacgaattggtatggacgatgca
atcatcacagttaagtatggtgcagatgttgaacctgttcgtttggttggtactgaagat
ggtacaatttcattaacaaaaagtggtgatcagaaatacgaagctgaattaccaattaaa
gatcatcatgcagcaattgatctgatgttaaaaaaattatcagatttaggaattattaaa
gattttcaagaaataacaggtgttggccatcgcgttgttgctggtggtgagtggttcaat
cattctgttgttgttgatgatgacgtgttatctaagatagatcgcttagctgattacgcc
ccactgcacaacccagctaatgcaatggggattcgagcattccaaaaattgttgccacat
gcgacttctgttgcagtgtttgatacatcatttcatcaaacaatgcctgaaaagaattat
ctatatagcttgccatatgaatactacgcacgctacggtgctcgtaaatatggtgcgcac
ggaacttcacatcgttatgtaactgaacgtgcggcagacaaattaggaataccattagac
gagtttaatgcgatttcatttcatttaggtgctggagcgtcagtaacggcaattaaaaat
ggtaagtcatacgatacgtcaatgggattcacaccacttgctggcttgacaatggcgact
cgttctggggatgtggatccatcattaatttattatattcaagaacgtgaaggcctttca
aatgaagaaatgcttaatgtcttaaataaaaaatctggtctattaggcatctcaactatt
tcaagtgatatgcgtgatttggaaaatgttcaggaaaccaatactcatgcgcaattggca
ttggatatgttctacgatcgtgtgattcgttatgcagggcagtattttgctgaactaggt
cgtgtggatgctattattttcacagcaggtatcggtgaaaacgatgcactaacacgtgct
aaagtattgaaatcattggcatttgcgggcgttgatctagatgaagaagcaaacaatgtt
cgtggtaaagaaacaattataacaacatccggttctaaagtaactgggttattgattccg
acaaatgaggaattaatgattgcacgtgatgtggtaacattacaaaacacaaaataa

DBGET integrated database retrieval system