KEGG   Leuconostoc mesenteroides subsp. mesenteroides J18: MI1_05740Help
Entry
MI1_05740         CDS       T01768                                 

Definition
(GenBank) aldose epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
lmm  Leuconostoc mesenteroides subsp. mesenteroides J18
Pathway
lmm00010  Glycolysis / Gluconeogenesis
lmm00052  Galactose metabolism
lmm01100  Metabolic pathways
lmm01110  Biosynthesis of secondary metabolites
lmm01120  Microbial metabolism in diverse environments
lmm01130  Biosynthesis of antibiotics
Module
lmm_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:lmm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MI1_05740
   00052 Galactose metabolism
    MI1_05740
Enzymes [BR:lmm01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     MI1_05740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: AET30592
Position
complement(1195348..1196343)
Genome map
AA seq 331 aa AA seqDB search
MKVTEEVFGTLPDGEKVTAFTLENINHTQVTVISYGATWQSFSIERSGEKKELLVQFDDL
EHYLDNPFHFGNTIGRVGGRLSKTAYNLSGTSFTLTPNENGHVLHSSVNGFDTINWQGTA
RNMGTAAEIVLSHTFEDEFPGQLQMNVTYTLYDDDKLTIKFSGESTEPTLYNPMTHVYFN
LAGKDADITNHELRVASHKHVEVDDETIPTGRLVENQHSKFDFSQLRKIGNDQFDDAWLL
DEQRDEVGVIVQEPVSGRTLTVDSDRNGVVIFMTNPGIKDHDDDWAENAPFTALAVEMQT
LPDAVNHEGFGDIVLPANQVKEYTVTYKITD
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgaaagttacagaagaagtgtttggtacattgcctgatggcgaaaaggtaaccgcgttc
acgttagaaaacattaatcatactcaagtaacggttatatcgtatggcgcgacatggcag
tctttttctattgagcgatcaggagagaaaaaagaattgcttgttcaatttgatgattta
gagcattacttagacaatccttttcattttggaaatactattggacgtgtgggtggtcga
ttatctaaaactgcatacaatttatccggcacgtcattcacattaacaccaaatgaaaat
gggcatgtcttacattcaagtgtaaatggttttgatacgattaactggcaaggaacagca
cgcaacatgggtaccgctgcagaaattgttttgtcacatacgtttgaggatgaatttcct
ggccaattacagatgaatgtgacttacacactttatgacgacgataagttaacaattaag
tttagtggtgaatcaacagaaccaacactgtataatcctatgacacatgtttattttaat
ctagctggaaaagatgctgatatcacaaatcatgagttgcgagtggcatctcacaaacat
gttgaagtagatgacgaaacaattcctactggccgattggtagaaaatcagcattccaaa
tttgacttctcacagctacgtaaaattgggaatgatcaatttgatgacgcctggttgcta
gatgagcagcgtgatgaagttggtgttattgtgcaagagcctgttagtggccgaacacta
acagtcgattcagatcggaatggtgttgttatttttatgactaatccaggaatcaaagat
cacgatgatgattgggcagaaaatgcaccattcacagcacttgctgttgaaatgcaaaca
ttgccggacgccgtgaatcatgagggatttggggatattgtgctgccagctaatcaggtg
aaggaatacacggtgacttataagataacagattaa

DBGET integrated database retrieval system