KEGG   Listeria monocytogenes 08-5578 (serotype 1/2a): LM5578_1214Help
Entry
LM5578_1214       CDS       T01157                                 

Definition
(GenBank) hypothetical protein
  KO
K02304  precorrin-2 dehydrogenase / sirohydrochlorin ferrochelatase [EC:1.3.1.76 4.99.1.4]
Organism
lmn  Listeria monocytogenes 08-5578 (serotype 1/2a)
Pathway
lmn00860  Porphyrin and chlorophyll metabolism
lmn01100  Metabolic pathways
lmn01110  Biosynthesis of secondary metabolites
lmn01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:lmn00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    LM5578_1214
Enzymes [BR:lmn01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.76  precorrin-2 dehydrogenase
     LM5578_1214
 4. Lyases
  4.99  Other lyases
   4.99.1  Sole sub-subclass for lyases that do not belong in the other subclasses
    4.99.1.4  sirohydrochlorin ferrochelatase
     LM5578_1214
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_binding_7 Sirohm_synth_M RVP Shikimate_DH SIS
Motif
Other DBs
NCBI-ProteinID: ADB67964
Position
1197936..1198418
Genome map
AA seq 160 aa AA seqDB search
MMKYPIMLDITGKKVVIIGGGKVALRKITGLLDAGADILVVGLKILPEIKAMDVRVVEEA
YRPEHLKAAFMIFICTDNPEVNQCVLRDREAGQLVNDTTDQANSDFFNMATVTKNELIVG
ISTGGGNPSYAKKVKREVSQLVANLETEEIGKRNKNDKTC
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaatatccgataatgcttgatattacagggaaaaaggttgtcataatcggtggc
gggaaagtggcgcttaggaaaattacgggtctgctggacgcaggtgcagatattttggta
gttggactaaagattttgccggagattaaggcgatggatgtgcgggtagtggaggaagct
tatcgaccggaacatcttaaagcagcatttatgatatttatttgtacagataatccagaa
gtaaatcagtgtgttttgcgtgaccgagaagcaggacaacttgtgaatgatacgactgac
caagcaaattctgatttttttaatatggcgacagtaacgaaaaatgaattaattgttggg
atttcaacgggtggaggtaatccaagttacgcgaagaaagtgaagcgtgaggttagtcaa
ttggtagcaaatttagaaacggaagaaatcggaaagcgtaataaaaatgataaaacctgc
taa

DBGET integrated database retrieval system