KEGG   Listeria monocytogenes 08-5578 (serotype 1/2a): LM5578_1468Help
Entry
LM5578_1468       CDS       T01157                                 

Gene name
ribC
Definition
(GenBank) hypothetical protein
  KO
K11753  riboflavin kinase / FMN adenylyltransferase [EC:2.7.1.26 2.7.7.2]
Organism
lmn  Listeria monocytogenes 08-5578 (serotype 1/2a)
Pathway
lmn00740  Riboflavin metabolism
lmn01100  Metabolic pathways
lmn01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lmn00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    LM5578_1468 (ribC)
Enzymes [BR:lmn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.26  riboflavin kinase
     LM5578_1468 (ribC)
   2.7.7  Nucleotidyltransferases
    2.7.7.2  FAD synthetase
     LM5578_1468 (ribC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_syn Flavokinase CTP_transf_like Citrate_ly_lig UPF0489
Motif
Other DBs
NCBI-ProteinID: ADB68217
Position
1426745..1427689
Genome map
AA seq 314 aa AA seqDB search
MKTIYLHHPITTDEWTDINKVMALGFFDGVHLGHQAVIKQAKQIAGQKGLQTAVLTFDPH
PSVVLSNIRKQVKYLTPLEDKAEKMAKLGVDIMYVVRFTTQFSELSPQAFVDNYLVALHV
EHVVAGFDYSYGKKGEGKMTDLAKYADGRFEVTIVDKQTAASDKISSTNIRRAITEGELE
EANQLLGYPYTTKGTVIHGDKRGRTIGFPTANIRVNEDYLIPKLGVYAVKFRVNGETHLG
MASIGYNITFKDDQALSIEVYILDFHREIYGEEAEIEWYQFFRPELKFNGVEGLIAQLEK
DEQDTRAFFANLED
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgaagacgatatacttacatcatccgattacaacggacgagtggactgacataaacaaa
gtaatggcacttggtttttttgatggcgtccatttgggacatcaagcagttattaaacaa
gcgaaacagattgccggacaaaaaggacttcaaactgcagtgttaacctttgatccgcat
ccatctgtggttttaagcaatatacgaaaacaagtaaaatatctcacaccacttgaagat
aaagcagaaaaaatggctaaacttggcgtagatattatgtatgtagttcgctttacaaca
cagttttccgagctatctccgcaagcctttgtggataactatttagtcgctttacatgta
gaacatgtggtagctggtttcgactattcttacggtaaaaaaggtgaaggtaaaatgacc
gatttggctaaatatgctgatgggcgttttgaagttacgattgtcgataaacaaactgcc
gcaagcgacaaaataagttcaacaaacattagacgtgccatcacagaaggcgaactagaa
gaagcaaatcaattactgggctatccttatacaacgaaaggaaccgtgattcatggggac
aaacgcggcagaacaattgggtttccaacagcgaatatccgtgtaaatgaagattacttg
attccaaagcttggtgtctatgcagtgaaattccgcgtgaacggggaaactcatttaggg
atggctagcattggctacaatatcacgtttaaagacgatcaagcgctgtccattgaagtg
tatattctagattttcaccgcgaaatttacggcgaagaagcagaaattgaatggtatcaa
tttttccgcccagaacttaaatttaatggggtagaaggtttgattgctcagttagaaaaa
gacgaacaagatacaagagcattttttgctaatttagaggattaa

DBGET integrated database retrieval system