KEGG   Listeria monocytogenes 08-5578 (serotype 1/2a): LM5578_1774Help
Entry
LM5578_1774       CDS       T01157                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase subunit alpha
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
lmn  Listeria monocytogenes 08-5578 (serotype 1/2a)
Pathway
lmn00260  Glycine, serine and threonine metabolism
lmn00400  Phenylalanine, tyrosine and tryptophan biosynthesis
lmn01100  Metabolic pathways
lmn01110  Biosynthesis of secondary metabolites
lmn01130  Biosynthesis of antibiotics
lmn01230  Biosynthesis of amino acids
Module
lmn_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:lmn00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LM5578_1774 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    LM5578_1774 (trpA)
Enzymes [BR:lmn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     LM5578_1774 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA BtpA His_biosynth
Motif
Other DBs
NCBI-ProteinID: ADB68522
Position
complement(1740303..1741076)
Genome map
AA seq 257 aa AA seqDB search
MTKTLTNKLAEKEHAAVVTYIMGGDGGLDNLEEQLLFLEKSGVSAIEIGIPFSDPVADGP
IIQLAGLRALKEQVSLEAILNKLAMSKVQIPLIIMSYINPIFHLGIPKFVELVQKTPVKG
LIIPDLPYEHQKLITPELQGTDIALIPLVSLTSPKERLEEIAKQAEGFIYAVTVNGTTGV
RSEFDAHIDSHLAYLKSISPVPVLAGFGVSSIEHVEKFAHVCDGVIIGSKVVQMLHEEKT
AELGAFLQKAAEVRIKN
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgactaaaacattaacgaataaactagcggaaaaagagcatgctgctgtcgttacttat
attatgggtggagatggtggtttagataatttagaagaacagttattgtttctagaaaaa
tctggcgtaagcgcgattgaaattggcattcctttttctgatccggttgctgacggacca
attattcaacttgctgggttacgtgctttaaaggagcaagtgagtttagaagccatttta
aataaattggctatgagtaaagtgcaaattccgctaattattatgagttatattaatccg
atttttcatttaggtattccaaaatttgttgaattggtgcagaaaacgccggtgaaaggg
cttattattccggatttaccttatgagcaccaaaaactgattacaccagaacttcagggg
acagatatcgcactcattccactcgtttcattgactagcccgaaagagcgccttgaagaa
attgcgaaacaggcagaaggatttatatatgcagtaacagttaacggaactactggtgtg
aggagtgaatttgatgcccatattgatagccatttagcttatttgaaaagcattagccct
gttccagttctcgcaggttttggtgtttcttctattgaacatgtagaaaaatttgcgcac
gtatgtgatggtgtgataatcggtagtaaagtcgtgcaaatgttgcatgaagaaaaaacg
gcagagctaggagcgtttttacaaaaggctgctgaagttcgaatcaaaaactaa

DBGET integrated database retrieval system