KEGG   Listeria monocytogenes 08-5578 (serotype 1/2a): LM5578_2027Help
Entry
LM5578_2027       CDS       T01157                                 

Definition
(GenBank) hypothetical protein
  KO
K13038  phosphopantothenoylcysteine decarboxylase / phosphopantothenate---cysteine ligase [EC:4.1.1.36 6.3.2.5]
Organism
lmn  Listeria monocytogenes 08-5578 (serotype 1/2a)
Pathway
lmn00770  Pantothenate and CoA biosynthesis
lmn01100  Metabolic pathways
Module
lmn_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:lmn00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    LM5578_2027
Enzymes [BR:lmn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.36  phosphopantothenoylcysteine decarboxylase
     LM5578_2027
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.5  phosphopantothenate---cysteine ligase (CTP)
     LM5578_2027
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DFP Flavoprotein
Motif
Other DBs
NCBI-ProteinID: ADB68774
Position
complement(2019383..2020582)
Genome map
AA seq 399 aa AA seqDB search
MQGKNILLAVSGGIAVYKAVALTSKLTQAGANVKVMMTAHAQEFVPPLSFQVLSKNDVYT
DTFDEKKSSVVAHIDLADWADLVIVAPATANVIGKMANGIADDMVTTTILATEAPVWVAP
AMNVHMIQHPAVIRNINQLYTDGVRFIEPEEGYLACGYVGRGRLEEPEKIVLRIAEFFQE
DKELLQSKNVLVTAGATREKLDPVRYFTNHSTGKMGFSIAESAARHGANVTLITTSKALP
VPHGVEAIYVESAEEMHQAVNERKVSQDIFVMTAAVADYTPAQVSDQKIKKQPGDFTIAM
KRTKDILLEIGQHKTSEQVVIGFAAETENVEANARKKLTSKNADMIVANNISEAGAGFSG
DTNIVTFYRKDGSSEALPILDKKEVAEHIIKEAANFLRK
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgcaaggaaaaaatatcttactcgcagtgtccggtggcattgctgtttataaagcagtc
gcacttacaagtaaattaacgcaagcgggtgcaaacgttaaagtaatgatgacagcacat
gcacaagaatttgttccaccgctttcgttccaagtattatctaaaaatgatgtatacaca
gatacatttgacgaaaaaaaatcaagtgtagtcgcacatattgatttagccgattgggcc
gatttagtaatcgttgcacctgcaactgcaaatgtgattggtaaaatggcaaatggcatc
gcggatgatatggtaacgacaaccattcttgcaacagaggcaccagtttgggtagcacca
gcaatgaatgtccacatgattcagcatccagcagttattcggaatattaaccagctttac
acagatggtgttcgttttatcgaaccagaagaaggttacttggcatgtggctatgttggt
cgcggtcgcctcgaagaaccagaaaaaatcgttcttcggattgctgaattttttcaagaa
gataaagagcttcttcaaagcaaaaatgtgctagtaacagccggcgcaactcgcgaaaaa
ttagatccagtacgctatttcaccaaccattcaactgggaaaatgggctttagcatagca
gaatctgctgcgcgtcacggtgcgaatgttacactaattactacaagtaaggcacttccc
gtaccgcatggagtagaagcaatctatgtcgaatcggcagaagaaatgcatcaagctgtg
aatgaacgtaaagtgtcacaagatatttttgtgatgaccgcagcagttgccgattacacg
ccagcgcaagtctcagatcaaaaaattaaaaaacaacctggtgattttacaatagcaatg
aaacgaaccaaagatattttactcgaaatcggtcaacataaaacttcggagcaagtcgtg
attggctttgccgctgaaacagaaaatgtagaagcaaacgcacgtaaaaaactaacctcc
aaaaatgccgatatgattgttgccaacaatattagtgaggccggagcaggcttttccggt
gacacgaatatcgtgacattttaccggaaagatggttccagtgaagcgttaccgatacta
gacaaaaaagaagttgctgaacatatcatcaaagaagccgctaactttttaaggaagtga

DBGET integrated database retrieval system