KEGG   Listeria monocytogenes 08-5578 (serotype 1/2a): LM5578_2075Help
Entry
LM5578_2075       CDS       T01157                                 

Definition
(GenBank) hypothetical protein
  KO
K00287  dihydrofolate reductase [EC:1.5.1.3]
Organism
lmn  Listeria monocytogenes 08-5578 (serotype 1/2a)
Pathway
lmn00670  One carbon pool by folate
lmn00790  Folate biosynthesis
lmn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lmn00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    LM5578_2075
   00670 One carbon pool by folate
    LM5578_2075
Enzymes [BR:lmn01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     LM5578_2075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHFR_1
Motif
Other DBs
NCBI-ProteinID: ADB68822
Position
complement(2065874..2066356)
Genome map
AA seq 160 aa AA seqDB search
MIIFVWAQDRAGNIGKDNKMPWHLPGDLHFFKKTTTGKTLVMGRKTYESLGKALPNRKTI
VLTRDQGLKLDDAEILHSKEAVLALAETGEPIYIVGGAEIYRLFMDVADQLIVTKIDAEF
EADTAFPEVDWENFSEVAKEFHEKDEKNKYNYTFYTYERN
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgattatttttgtttgggcacaagaccgcgctggaaatattggaaaagataacaaaatg
ccgtggcacttaccaggagatttgcattttttcaaaaaaacaacgactgggaaaacactt
gtcatggggcggaaaacctatgaatcgttaggaaaagctttaccaaatagaaagacaatc
gtattgacacgagatcaaggtctcaagttagatgatgcagagatacttcattcaaaagaa
gctgttttagcccttgctgagacaggggaaccaatctatatagttggtggtgcagaaatc
tatcgtttatttatggatgtggcggatcagctgattgtgacaaaaattgatgcagagttt
gaggctgatactgcgtttcctgaagtggattgggagaatttttccgaagtggcgaaagaa
ttccatgaaaaagatgaaaaaaataagtacaattacactttttatacgtatgaaagaaat
tag

DBGET integrated database retrieval system