KEGG   Listeria monocytogenes EGD-e (serotype 1/2a): lmo1406
Entry
lmo1406           CDS       T00066                                 

Symbol
pflB
Name
(RefSeq) pyruvate formate-lyase
  KO
K00656  formate C-acetyltransferase [EC:2.3.1.54]
Organism
lmo  Listeria monocytogenes EGD-e (serotype 1/2a)
Pathway
lmo00620  Pyruvate metabolism
lmo00640  Propanoate metabolism
lmo00650  Butanoate metabolism
lmo01100  Metabolic pathways
lmo01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:lmo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    lmo1406 (pflB)
   00640 Propanoate metabolism
    lmo1406 (pflB)
   00650 Butanoate metabolism
    lmo1406 (pflB)
Enzymes [BR:lmo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.54  formate C-acetyltransferase
     lmo1406 (pflB)
SSDB
Motif
Pfam: PFL-like Gly_radical DUF3029
Other DBs
NCBI-GeneID: 986171
NCBI-ProteinID: NP_464931
Pasteur: LMO01406
UniProt: Q8Y786
Position
1435635..1437866
AA seq 743 aa
MTEQWYEFAGGNWQQEVDVRDFILKNYRLYDGDDTFLVGPTEATTKLWDQVMDLTKKERE
NGGVLDMDTKIVSTITSHDPGYLNKDLEKVVGVQTDVPFKRALQPFGGIRMAEVAAESYG
FKVDEEISHIFSEYRKTHNQGVFDAYTAEMRAARKSGVITGLPDAYGRGRIIGDYRRVAL
YGVDFLIKQKKQDLNNTGLRTMSDDVIRQREELNEQIRALGELKVLGEKHGFDLGRPAKT
AQEAFQWLYLGYLAAIKEQNGAAMSLGRTSTFLDIYVERDLRNGLITEEEAQEIVDHFIM
KLRLVKFARTPDYNELFSGDPTWVTESIGGITEEGVPLVTKNSFRFLHTLDNLGPAPEPN
LTVLWSTHLPSGFKKFCAKMSIKTSAIQYENDDVMRPKWGDDYAIACCVSAMRVGKQMQF
FGARANLAKTLLYAINGGIDEKSKAQVGPAYRPIEGDVLDYKEVMEKYDAMMEWIAELYL
NTLNVIHYMHDKYAYERIEMALHDTEVLRTMATGIAGLSVAADSLSAIKYATVRPIRDED
GIVVDYEIEGDYPKYGNNDDRVDEIAVELLKTFMTKVRKHKTYRDAVHTTSVLTITSNVV
YGKKTGNTPDGRRAGEPFAPGANPMHGRDTKGALASLSSVAKLPYEYGQDGISNTFSIVP
KALGREDESQINNLVAMLDGYSTKMGHHLNINVFNRDTLLDAMDHPEEYPQLTIRVSGYA
VNFIKLTREQQLDVIHRTMHESM
NT seq 2232 nt   +upstreamnt  +downstreamnt
atgactgaacaatggtatgaattcgcaggtggtaactggcaacaagaagtagatgtacgt
gactttatcttaaaaaactatcgcttatatgacggtgacgacactttcctagttggccca
accgaagcaactacaaaactttgggatcaagtaatggacttaactaaaaaagaacgtgaa
aacggtggcgtactggatatggataccaaaatcgtttcaaccatcacttcacatgaccca
ggatacttaaataaagatttagaaaaagttgtcggcgttcaaactgacgtacctttcaaa
cgcgctttacaaccattcggcggaatccgtatggcagaagttgcagctgaatcttatgga
tttaaagtagacgaagaaattagccatattttctctgaataccgtaaaacacataaccaa
ggtgtatttgatgcttacacagcagaaatgcgcgcagctcgtaaatcaggcgtaattact
ggtcttccagatgcttatggccgtggacgcattatcggtgactaccgtcgtgtagcactt
tacggtgtagacttcttaattaaacaaaagaaacaagatttaaacaatacaggtttgcgt
acaatgagcgatgacgttatccgtcaacgtgaagaacttaacgaacaaattcgtgcttta
ggtgaattaaaagttctaggtgaaaaacatggtttcgaccttggtcgtccagctaaaaca
gcacaagaagctttccaatggttataccttggttacctagctgcaattaaagaacaaaat
ggtgctgcaatgagtttaggacgtacatctacattccttgatatttatgtagaacgtgat
cttcgtaatggcctaattactgaagaagaagcacaagaaatcgttgaccactttatcatg
aaattacgtcttgtaaaatttgctcgtacaccagattacaacgaattattctctggagat
ccaacttgggttactgaatccatcggtggtattacggaagaaggcgttccacttgtaacg
aaaaactcattccgtttcttacacactttagataacttaggacctgctccagaaccaaac
ttaacagtactttggtccactcatttaccatcaggattcaagaaattctgtgctaaaatg
tctatcaaaacatcagctattcaatacgaaaatgatgatgttatgcgccctaaatgggga
gacgactatgcgattgcatgttgtgtatccgcaatgcgcgttggtaaacaaatgcaattc
tttggtgctcgtgccaaccttgctaaaacactactttacgcaatcaatggtggtatcgat
gaaaaatctaaagcacaagttggaccagcttatcgtccaattgaaggtgatgtattagat
tacaaagaagtaatggaaaaatatgatgcaatgatggaatggattgcagaactttatctt
aatacactaaatgtaattcattacatgcatgataaatacgcttacgaacgtatcgaaatg
gctttacatgatacagaagtattacgtactatggcaactggtatcgctggactttctgtt
gcagctgactccttatccgctattaaatatgcaactgttcgtccaattcgtgacgaagat
ggcatcgtagttgattatgaaatcgaaggcgactatcctaaatacggaaataatgatgac
cgtgtagatgaaatcgcagttgagcttctaaaaacattcatgactaaagtaagaaaacat
aaaacttaccgtgatgcagttcacacaacttctgttcttacaatcacttctaacgtggtt
tatggtaagaaaactggtaatacaccagacggacgtcgtgcaggcgaaccatttgcacca
ggtgcgaatccaatgcatggccgtgatacaaaaggtgctctagcttctctatcttcagtt
gctaaacttccttacgaatatggtcaagatggtatctctaacacattctctatcgtacca
aaagctttaggtcgcgaagatgaatctcaaattaataacttagttgcaatgcttgatggt
tattccacaaaaatgggacatcacttaaacatcaacgtattcaatcgtgatacgttacta
gatgctatggatcacccagaagaatatccacaattaactatccgcgtttccggatatgca
gttaacttcatcaaactaactcgtgaacaacaattagatgttattcaccgtacaatgcac
gaatccatgtaa

DBGET integrated database retrieval system