KEGG   Listeria monocytogenes EGD-e (serotype 1/2a): lmo2324
Entry
lmo2324           CDS       T00066                                 
Name
(RefSeq) anti-repressor
  KO
K07741  anti-repressor protein
Organism
lmo  Listeria monocytogenes EGD-e (serotype 1/2a)
Brite
KEGG Orthology (KO) [BR:lmo00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99973 Transcription
    lmo2324
SSDB
Motif
Pfam: ANT AntA TUTase DUF3152 DUF5632
Other DBs
NCBI-GeneID: 986505
NCBI-ProteinID: NP_465848
Pasteur: LMO02324
UniProt: Q8Y4V6
Position
complement(2396454..2397230)
AA seq 258 aa
MSNLQVIANEMLPVLENEQGEKFVDARMLHEKLLVNTRFNDWIYRMIGNYGYENGLDFYS
TLSKTNGRPSTNYFLTLDTAKELAMVQNNEMGRAIRKYFIEVEKQARKLATEYPAFSYMI
EDPVARAKKWIEEQQEKQEVLKKLEEQKPKVVFAEAVQTSENTILVKDLATILKQKGLDI
GQNRLFEWLRGSGYLLSKGAYYNKPSQKAMNLGLFEQKTHIHTDRNGLMKTTYTPQVTGK
GQVYLLNKLLEEHNQVII
NT seq 777 nt   +upstreamnt  +downstreamnt
atgtcaaatttacaagtaattgcaaatgaaatgttgccagttttagaaaatgaacaaggc
gaaaaatttgttgatgcccggatgcttcatgaaaagcttttagtaaatacaagatttaat
gattggatatatagaatgattggaaattatggttatgagaatggtttagacttttactca
actttgagtaaaaccaatgggcgaccatcaacaaattattttttgactttagatactgct
aaagaattagcaatggtgcaaaacaacgaaatgggtcgagcaattagaaaatacttcatt
gaagtagaaaaacaagcgaggaaattagcaactgaatatcccgcattttcatacatgata
gaagatccagtcgctagagctaaaaaatggatagaggaacaacaagaaaagcaagaggtg
ttaaaaaaacttgaggaacaaaagccgaaagtagtttttgcggaagctgtgcaaacgagt
gagaacacaattttagtaaaagatttagctactattctaaaacaaaaaggattagatata
ggacaaaacaggctttttgaatggctgagaggaagcggttatttgctaagtaaaggtgct
tattacaacaaaccgtcgcaaaaggcgatgaacttaggattgtttgaacaaaaaacacat
attcatacagatagaaacggcttaatgaaaaccacttatactccacaagtaacaggaaaa
ggacaagtatatctattaaacaagttattagaagaacacaatcaagtcataatttaa

DBGET integrated database retrieval system