KEGG   Listeria monocytogenes EGD-e (serotype 1/2a): lmo0078Help
Entry
lmo0078           CDS       T00066                                 

Definition
(RefSeq) phosphoglycerate dehydrogenase
Organism
lmo  Listeria monocytogenes EGD-e (serotype 1/2a)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh F420_oxidored IlvN NAD_binding_2 NAD_binding_7 3HCDH_N
Motif
Other DBs
NCBI-GeneID: 986565
NCBI-ProteinID: NP_463611
Pasteur: LMO00078
UniProt: Q8YAN9
Position
81661..82617
Genome map
AA seq 318 aa AA seqDB search
MTASVFVAGKLLPETMEALSKWDVKAFSGEENITEAELINNVTEVDAIICPLSSPISAKV
LESAKNLKIVANIGAGFDNIDVKKAQELGIAVTNTPDVSTEATAELTLGLILDVARRISE
GDRLCRETPEQFKGWAPTFFLGTELSGKTLGIIGLGRIGQAVAKRAAAFGMNIIYSGHQP
KEAAKEWNAEFVSQKELLKRSDVVTIHAAYSPSLKHLLNETTLKTMKSSAFLINAARGPV
VEEAALIKALETGVIAGAALDVFEFEPKIGEDFAKLDNVVLTPHIGNATVETRAAMGKIA
IANVEAVLAGKAPLHSVY
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgacagcgagcgtatttgtagcaggaaaattactaccagaaacgatggaagctcttagc
aaatgggacgttaaagctttttcgggtgaggaaaatattacagaagcagagttaataaac
aatgtaacggaagtggatgcgattatttgcccgctttcttccccaatttcggcaaaagta
ttggaatcggcaaaaaatcttaaaatcgtggcgaatattggtgccggttttgacaatatc
gatgtaaaaaaagcgcaagaattgggcattgcagtgaccaatacgccagatgtgtcaacg
gaagcaacggcggaactaacgcttggattaattttagacgtagcgcggagaatttcagaa
ggcgaccgattatgccgcgaaacccccgagcaattcaaaggctgggcaccaacgttcttt
ttaggtactgaattaagtggcaaaacgcttggaattattggattaggaagaatcggtcaa
gctgtcgcaaaacgtgcggctgcttttggaatgaacattatttattctggacaccagccg
aaagaagcagcgaaagagtggaatgcagagtttgtgagccagaaagaattattgaagcgc
agcgatgttgtaacaatccatgcagcatacagtcccagcttgaaacatctgctgaacgaa
acaacactgaaaacgatgaaatcaagtgcttttttgatcaatgctgctcgcggtcctgtt
gtggaggaagctgcactgattaaggcattagaaacaggcgttatcgccggcgctgcgctg
gatgtgtttgagttcgagcctaagattggcgaggattttgctaaactggataatgtcgtt
ttaacaccccatatcggaaacgcaaccgtggaaacacgcgcagcaatgggcaaaatcgct
attgcaaatgtcgaggctgtattagcaggaaaagcaccactacattctgtttattaa

DBGET integrated database retrieval system