KEGG   Listeria monocytogenes EGD-e (serotype 1/2a): lmo0224Help
Entry
lmo0224           CDS       T00066                                 

Gene name
sul
Definition
(RefSeq) dihydropteroate synthases
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
lmo  Listeria monocytogenes EGD-e (serotype 1/2a)
Pathway
lmo00790  Folate biosynthesis
lmo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lmo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    lmo0224 (sul)
Enzymes [BR:lmo01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     lmo0224 (sul)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind PEP_mutase DUF3783
Motif
Other DBs
NCBI-GeneID: 987081
NCBI-ProteinID: NP_463755
Pasteur: LMO00224
UniProt: Q8YAC2
Position
232662..233477
Genome map
AA seq 271 aa AA seqDB search
MKKWKRDHLGMVMGILNVTPDSFSDGGKYMQVEEAVARALQMAEDGAAIIDVGGISTRPG
FSEVTPDEELARIIPVIKAVRTKLPDIWISVDSWRAEVAEQAILAGADMINDQWGAKKEP
KIAEVAAKYDVPICLMHNRENAQYDNFLEDVKKDLLESIAIAKAASVPDEHIILDPGFGF
VKTPAQNLEVLRRIDEIVALGYEVLLGTSRKSTIGLVLGTTPGDRMEGTGATTVYGFSKG
CTITRVHDVLPIARMVRMTDAITGKLDITNL
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
ttgaagaagtggaaaagggatcacctaggtatggtcatggggatattgaatgttacgcca
gattctttttcagatggcgggaaatatatgcaagtagaagaagcggtggctcgagcgtta
caaatggcggaagatggagcagcgattattgacgttggaggaatatctactcgtcctggt
ttttcggaagtaacccccgatgaagaacttgcccgaattataccggtcattaaagctgtc
aggacgaaattacccgatatatggatttccgttgattcttggcgtgctgaagtagcggaa
caggctatcttagcgggagctgatatgataaatgaccagtggggtgcgaaaaaagaaccg
aaaattgccgaagttgctgcaaaatacgatgtaccgatttgtttaatgcacaatcgtgag
aacgcgcaatacgacaattttttagaagatgtgaaaaaagacttgttagaaagtattgcc
atagctaaagcagcatcagtaccagacgagcatattattctcgatccaggttttggtttt
gttaagacacctgctcagaatttagaagtgttacgacggattgatgagatagtcgcactt
ggttacgaggttttactcggtacgagcaggaagtcaactattgggcttgtcctaggaact
actcctggagatagaatggaaggaactggagcaacaactgtctatggattttcgaaaggt
tgtacaattactcgtgtccatgatgtacttccaattgcacgtatggtgcgaatgacagat
gcaatcactggcaaattagatattacaaatttataa

DBGET integrated database retrieval system