KEGG   Listeria monocytogenes EGD-e (serotype 1/2a): lmo0825Help
Entry
lmo0825           CDS       T00066                                 

Definition
(RefSeq) 3-hydroxy-3-methylglutaryl-CoA reductase
  KO
K00054  hydroxymethylglutaryl-CoA reductase [EC:1.1.1.88]
Organism
lmo  Listeria monocytogenes EGD-e (serotype 1/2a)
Pathway
lmo00900  Terpenoid backbone biosynthesis
lmo01110  Biosynthesis of secondary metabolites
lmo01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:lmo00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    lmo0825
Enzymes [BR:lmo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.88  hydroxymethylglutaryl-CoA reductase
     lmo0825
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMG-CoA_red
Motif
Other DBs
NCBI-GeneID: 985372
NCBI-ProteinID: NP_464352
Pasteur: LMO00825
UniProt: Q8Y8R9
Position
851225..852505
Genome map
AA seq 426 aa AA seqDB search
MNAFDKFYKKTVEERHAILAEYADLNEEEQAFLASTGALSFDKANHMIENTIGIYSLPLG
LGMNMLLNDKRYVVPMAMEEPSVVAAQSAGAKLIAQNGGITGSATKRKMIGQIELISVSD
IQAAKENIIANEEQLIAIANQAHPSLQKRGGGAVKIQVRTAQTANDETLFIVHLLVDTQE
AMGANMVNTMVETLAPELEMLTNGTANMRILSNLVDEATATAVCRINPESLATKTQSGEW
VRDRIIAAYEFADADIYRAATHNKGIMNGIDAVIMAFGNDWRAVEAASHAYAARTGSYKP
MSKWSKDADGYLVGELTLPMPVAFVGGSIAIHPIASLSKKIARVESAKELAMLVCAVGLT
QNLAALKALVTEGIQRGHMSLQAKSLAMTAGAEADEIEIVATFLQESKQLNVVAAKEFIA
KLRSEK
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcttttgataaattttataaaaaaacagtagaagaacgacatgcaattttggcg
gaatatgctgatttaaatgaagaagaacaagcatttttagcttctacaggggcgctttct
tttgataaagcgaatcatatgattgaaaacacgattggtatttattcgctgccgctcgga
ttaggaatgaatatgcttttaaatgataaacgttatgttgtacccatggcgatggaggag
ccttctgttgtggcggcacaaagcgctggggcaaaacttattgcacaaaatggcgggata
actggaagtgcaacgaaacgaaaaatgattggtcagattgagttgatttctgtttctgat
atccaagcagcaaaagaaaacatcattgcgaacgaagaacaactaattgctatcgctaac
caagctcatccatcgttacaaaagcgtggcggtggtgcggttaaaattcaagtcagaaca
gcacaaacagcgaatgacgaaacgttatttatcgttcatttactcgtagacacccaagaa
gcaatgggcgcgaatatggtcaatacgatggtcgaaaccctagcaccagaattagaaatg
ttgacgaacggaacagccaatatgcgcattttatctaatttagtagatgaagcgaccgca
actgctgtttgtcggattaatccagaaagcttggcaaccaaaacccagagcggtgaatgg
gttcgtgatagaattattgctgcatatgaatttgccgacgcggatatttaccgggcagca
acacataataaaggaataatgaatggcattgatgcggtaattatggcgtttgggaacgat
tggcgcgcggtagaagcagcaagtcacgcctacgcagccagaacaggaagctataaaccg
atgtctaagtggtcaaaagatgcggacgggtatttggttggggagctaactttaccgatg
ccagtggcctttgtaggtggttctatagcgattcatccgattgcgagtctttctaaaaaa
attgctcgagtagaatcagcgaaggaactagcgatgttagtttgtgccgttggattaacg
caaaatctcgctgctttaaaagcactcgtaacagaaggtattcaacgtggtcatatgtca
ctacaagcgaaatctcttgcaatgacagctggcgcagaagcagatgaaatcgaaatagta
gccacatttttgcaagaaagcaaacaattaaacgtagtcgctgccaaagaatttatcgcg
aaattgcgcagcgaaaaataa

DBGET integrated database retrieval system