KEGG   Listeria monocytogenes EGD-e (serotype 1/2a): lmo1082Help
Entry
lmo1082           CDS       T00066                                 

Definition
(RefSeq) dTDP-sugar epimerase
  KO
K01790  dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
lmo  Listeria monocytogenes EGD-e (serotype 1/2a)
Pathway
lmo00521  Streptomycin biosynthesis
lmo00523  Polyketide sugar unit biosynthesis
lmo01130  Biosynthesis of antibiotics
Module
lmo_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:lmo00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    lmo1082
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    lmo1082
Enzymes [BR:lmo01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     lmo1082
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dTDP_sugar_isom
Motif
Other DBs
NCBI-GeneID: 986259
NCBI-ProteinID: NP_464607
Pasteur: LMO01082
UniProt: Q8Y836
Position
1116532..1117092
Genome map
AA seq 186 aa AA seqDB search
MEIVESKLAGVKLVKPKVFGDHRGFFMESYNEKAFHEAGIDMKFIQDNHSLSVEAGVLRG
MHYQTNPKAQTKLIRVATGAIYDVVVDMRKGSPTYGEWEGYILSEANKHQLLVPQGFAHG
FCTITENVNVLYKVDQLYSPENDAGIAYDDPDLNITWPTDKLILSDKDTKHPRLKDAENN
FVWENK
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atggaaattgttgaaagtaaactagctggtgttaaattagtaaaaccaaaagtgtttgga
gatcatcgtggttttttcatggaaagctataatgaaaaagcattccatgaagctggaatc
gatatgaagtttattcaagataaccactctctttctgtggaagcgggtgtacttcggggt
atgcattatcaaacgaacccaaaagcacagacaaaattaattcgtgttgcgacaggcgca
atttatgatgtagttgttgatatgcgtaaaggttctcctacatacggtgagtgggaaggt
tatattttaagcgaagcaaacaaacatcaacttctagtaccacaaggatttgctcatggc
ttttgtacgattaccgaaaatgtgaatgtgctttataaagtagatcaattatattcccct
gaaaacgatgcgggaattgcctacgatgatccggatttaaatattacttggccaacagat
aaattaattttatcggacaaggatacgaaacatccacgtttaaaagacgctgaaaataat
tttgtatgggagaataaataa

DBGET integrated database retrieval system