KEGG   Listeria monocytogenes EGD-e (serotype 1/2a): lmo1104Help
Entry
lmo1104           CDS       T00066                                 

Definition
(RefSeq) P60 protein
Organism
lmo  Listeria monocytogenes EGD-e (serotype 1/2a)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lysozyme_like NLPC_P60 SLT DUF1175 CHAP DUF4441
Motif
Other DBs
NCBI-GeneID: 986227
NCBI-ProteinID: NP_464629
Pasteur: LMO01104
UniProt: Q8Y815
Position
complement(1138930..1139940)
Genome map
AA seq 336 aa AA seqDB search
MKLVKYFAIFGVVFSMFFSLLLFVTIVFAEEDDTRSSREEMIQQGGLNVSAEVLAHRPMV
EKYCKEFGIEEYVNYILAIMQVESGGTAEDVMQSSESLGLPPNSLSTEESIKQGCKYFSE
LLASAESNGCDINTVIQSYNYGGGFINYVASNGKKYSYELAESFSKDKAGGVKVDYPNPI
AIPVNGGWRYNYGNQFYVLLVSQYLTPVQFDDETVQAIMNEALKYEGYPYVFGGSSPSTS
FDCSGLTQWSYAVAGIQLPRVAQAQYDATQHIPLSEAKAGDLVFFHSTYDAGSYVTHVGI
YVGNNQMYHAGDPIGYTNLTDSYWQAHLIGAGRIIK
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaagctagtaaaatacttcgccatctttggagtggttttctctatgttctttagtctg
ttgctatttgtaactatcgtttttgcagaggaagatgatacacgtagtagcagagaagaa
atgattcaacaaggtggtctaaatgtatcagcagaggtactggcacatagaccaatggtt
gagaagtattgtaaggagtttggcattgaagaatacgtgaattacattctagcaattatg
caggtggaatctggcggaactgccgaagatgttatgcaatcctcggaatctttaggactt
ccaccgaacagccttagtacagaagaatccatcaaacagggttgtaaatactttagtgag
ctattagctagtgctgaaagcaacggttgtgatattaacacagtcattcaatcctacaat
tatggtggtggctttatcaactatgtagctagtaatggaaaaaagtacagctatgaactt
gcagaatctttttcaaaggataaagcaggtggtgtgaaagttgactatcctaaccctatt
gcaattcctgtaaatggtggttggcggtacaactatggaaatcagttttatgtattgctt
gtttctcaataccttacaccagtccagtttgatgatgaaaccgtgcaagcgattatgaat
gaagcactgaaatatgagggctacccttatgtgtttggtggttcttctccctctacttct
tttgattgtagcggattgacacaatggagctatgcagttgcagggattcaacttcctaga
gttgcacaagctcaatatgacgcaacacagcatatccccttatcagaagccaaagcaggc
gatttagttttcttccactctacctatgacgctggtagttacgtgacgcacgttggaatc
tatgttggtaataaccaaatgtaccacgcaggtgatcctattggttataccaaccttacc
gacagttattggcaagctcatttaattggagctggacgcattatcaaatag

DBGET integrated database retrieval system