KEGG   Listeria monocytogenes EGD-e (serotype 1/2a): lmo1107
Entry
lmo1107           CDS       T00066                                 

Definition
(RefSeq) hypothetical protein
Organism
lmo  Listeria monocytogenes EGD-e (serotype 1/2a)
SSDB
Motif
Pfam: TcpE PrgI
Other DBs
NCBI-GeneID: 986244
NCBI-ProteinID: NP_464632
Pasteur: LMO01107
UniProt: Q8Y812
Position
complement(1144533..1144928)
AA seq 131 aa
MKKIRSYTSIWNVEKVIYAINDLQLPFPITFTQMTWFIVSLLVIVMFGSLPPLSLIDGAL
LKYIGIPVGLAWFMSQKTFDGKKPYGFLKSILTYFIRAKTTYAGKAVKLQKQQFNEAITT
VRSELYYGISN
NT seq 396 nt   +upstreamnt  +downstreamnt
atgaaaaaaataagaagctacaccagcatttggaacgtagaaaaagtaatctacgccatc
aatgatttacaactaccatttcccataacttttacgcaaatgacatggttcattgtttca
ctacttgttatcgttatgtttggtagcctaccgcctttatcgcttattgatggggcgttg
ctaaagtatattgggattccagtaggcttggcttggtttatgagccaaaagacgtttgac
ggcaagaaaccctatggatttttaaagtctatcctcacgtattttatacgggcaaaaact
acctatgcaggaaaagccgtgaaacttcaaaagcaacaattcaatgaagcaataacaacc
gtaaggagtgaactgtattatggcatatccaattaa

DBGET integrated database retrieval system