KEGG   Listeria monocytogenes EGD-e (serotype 1/2a): lmo1109
Entry
lmo1109           CDS       T00066                                 
Name
(RefSeq) hypothetical protein
Organism
lmo  Listeria monocytogenes EGD-e (serotype 1/2a)
SSDB
Motif
Pfam: Flp_Fap Wzy_C
Other DBs
NCBI-GeneID: 986220
NCBI-ProteinID: NP_464634
Pasteur: LMO01109
UniProt: Q8Y810
Position
complement(1145723..1145944)
AA seq 73 aa
MNFGQNLYNWFLSNAQSLVLLAIVVIGLYLGFKREFSKLIGFLIIALIAVGLVFNAGGVK
DVLLNLFNRIIGA
NT seq 222 nt   +upstreamnt  +downstreamnt
atgaattttggacaaaacttatacaactggtttttgagtaacgcacaatcccttgtctta
ctggcaatcgtagtcattggactatatttggggttcaaacgagagttttcaaaactaatc
ggattcttgattatcgcactgattgccgtaggactggtattcaatgcagggggcgtgaaa
gacgtactgctgaacctattcaatcgaatcattggagcttag

DBGET integrated database retrieval system