KEGG   Listeria monocytogenes EGD-e (serotype 1/2a): lmo1348Help
Entry
lmo1348           CDS       T00066                                 

Gene name
gcvT
Definition
(RefSeq) glycine cleavage system aminomethyltransferase T
  KO
K00605  aminomethyltransferase [EC:2.1.2.10]
Organism
lmo  Listeria monocytogenes EGD-e (serotype 1/2a)
Pathway
lmo00260  Glycine, serine and threonine metabolism
lmo00630  Glyoxylate and dicarboxylate metabolism
lmo00670  One carbon pool by folate
lmo01100  Metabolic pathways
lmo01110  Biosynthesis of secondary metabolites
lmo01130  Biosynthesis of antibiotics
lmo01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:lmo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    lmo1348 (gcvT)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    lmo1348 (gcvT)
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    lmo1348 (gcvT)
Enzymes [BR:lmo01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.10  aminomethyltransferase
     lmo1348 (gcvT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GCV_T GCV_T_C SoxG
Motif
Other DBs
NCBI-GeneID: 987736
NCBI-ProteinID: NP_464873
Pasteur: LMO01348
UniProt: Q8Y7D5
Position
1373015..1374103
Genome map
AA seq 362 aa AA seqDB search
MTELLKTPIHPLYAKYGAKTIDFGGWDLPVQFAGIKAEHEAVRTDAGLFDVSHMGEILVK
GPDSTSYLQYLLSNDIEKIKIGKAQYNIMCYETGGTVDDLVVYKKSETEYILVVNAANTD
KDFEWMVKNIRGDVSVTNVSSEYGQLALQGPNAEKILSKLTDVDLSSISFFGFVEDADVA
GVKTIISRSGYTGEDGFEIYMPSADAGKVFEAILAEGVAPIGLGARDTLRLEAVLALYGQ
ELSKDITPLEAGLNFAVKLKKEADFIGKEALIKQKEAGLNRKLVGIELIERGIPRHDYPV
FLNEEQIGVVTSGTQSPTLGINIGLALIDTAYTELGQEVEVGIRNKKVKAKIVPTPFYKR
AK
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgacagagctactaaaaacaccgattcatccactttatgcaaaatatggtgcgaaaacc
attgattttggtgggtgggatttaccggtacaatttgctggtataaaagcagaacatgag
gccgtgcgaactgatgcagggttatttgacgtgtctcacatgggagaaattctagtaaaa
ggacctgatagtacttcttatttacagtatttgttatcaaacgacatagaaaaaataaaa
atcggaaaagcgcaatataatattatgtgctatgaaactggcggaacagtggacgatcta
gtagtttataagaaatcagaaacggaatacatacttgttgtcaatgcagcaaacacggac
aaagattttgaatggatggttaaaaatattcgcggggatgtttctgttaccaatgtatct
tcggaatatggacaattagcacttcaagggccaaacgccgaaaaaattctctcgaaacta
acggatgtagatttaagctcgattagcttctttggatttgtggaggatgcggatgtagct
ggagtgaaaacaatcatttcaagaagtggatatactggagaagatggatttgaaatttat
atgccaagcgcagatgcaggaaaagtatttgaggcgattttggctgaaggtgtcgctcca
attggtttaggcgcacgggatacattgcgtttagaggcagtacttgcgctttatggacaa
gaattaagcaaagacattactccacttgaagctggcctcaattttgctgttaaattgaaa
aaagaagcagattttataggcaaagaagccctaattaaacaaaaagaagcagggctgaac
agaaaattagttggtattgaattaatcgaacgaggtattccacgtcacgattatccagta
tttttaaatgaggaacaaatcggcgttgtgacttcaggcacgcaatcaccaacacttgga
ataaatattggtctcgctttaattgatacagcttacacagaattgggtcaagaagtagaa
gtaggcataagaaataaaaaagtaaaagcaaaaatagtaccaacaccattttataaacgc
gcaaagtaa

DBGET integrated database retrieval system