KEGG   Listeria monocytogenes EGD-e (serotype 1/2a): lmo1360Help
Entry
lmo1360           CDS       T00066                                 

Gene name
folD
Definition
(RefSeq) bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/5,10-methylene-tetrahydrofolate cyclohydrolase
  KO
K01491  methylenetetrahydrofolate dehydrogenase (NADP+) / methenyltetrahydrofolate cyclohydrolase [EC:1.5.1.5 3.5.4.9]
Organism
lmo  Listeria monocytogenes EGD-e (serotype 1/2a)
Pathway
lmo00670  One carbon pool by folate
lmo01100  Metabolic pathways
lmo01120  Microbial metabolism in diverse environments
lmo01200  Carbon metabolism
Module
lmo_M00140  C1-unit interconversion, prokaryotes
Brite
KEGG Orthology (KO) [BR:lmo00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    lmo1360 (folD)
Enzymes [BR:lmo01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.5  methylenetetrahydrofolate dehydrogenase (NADP+)
     lmo1360 (folD)
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.9  methenyltetrahydrofolate cyclohydrolase
     lmo1360 (folD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: THF_DHG_CYH_C THF_DHG_CYH OCD_Mu_crystall AdoHcyase_NAD RL acVLRF1 Semialdhyde_dh adh_short SUB1_ProdP9
Motif
Other DBs
NCBI-GeneID: 987879
NCBI-ProteinID: NP_464885
Pasteur: LMO01360
UniProt: Q8Y7C5
Position
1383489..1384343
Genome map
AA seq 284 aa AA seqDB search
MGEIIDGKKLAKEIQEKVTREVAELVKEGKQPGLAVVLVGDNQASRTYVRNKQKRTEEAG
MKSVLIELPENVTEEKLLSVVEELNEDKTIHGILVQLPLPEHISEEKVIDTISFDKDVDG
FHPVNVGNLFIGKDSFVPCTPAGIIELIKSTGTQIEGKRAVVIGRSNIVGKPVAQLLLNE
NATVTIAHSRTKDLPQVAKEADILVVATGLAKFVKKDYIKPGAIVIDVGMDRDENNKLCG
DVDFDDVVQEAGFITPVPGGVGPMTITMLLANTLKAAKRIWKMN
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgggagaaattattgatggcaaaaagttagcaaaagaaattcaagaaaaagtaacaaga
gaagtagctgaattagtaaaagaaggtaaacaacctggtcttgctgttgtgctcgtaggc
gacaatcaagcatctcgtacatatgtaagaaataaacaaaaaagaacagaagaagcgggt
atgaaatctgttttaattgaacttccagaaaatgtaacagaagaaaaattactatctgtc
gtagaagagctaaatgaagataaaaccattcacggcatactcgttcagttaccactacca
gaacacatttcagaagaaaaagtaattgatactattagctttgacaaagatgttgacggt
tttcatccagtgaatgtaggtaatttattcattggaaaagattcatttgttccttgtaca
ccagctggaattattgaacttataaaatcaaccggcactcaaatagaaggtaaacgcgct
gtcgttattggtagaagtaatatcgtagggaaaccagtagcccaattactgttaaatgaa
aacgcgacagtaaccattgcgcatagccgtacaaaagatttaccacaagtagcgaaagaa
gcggatattcttgttgtagcaacaggtttagctaaatttgtgaaaaaagactatatcaaa
ccaggtgcgattgttattgatgttggcatggatcgcgacgaaaataataagttatgcggt
gatgttgactttgatgacgtagtacaagaagcgggattcattacgccagtaccaggtggc
gttggcccgatgacaatcacaatgctacttgcgaacacattaaaagcagcaaaacgcatt
tggaaaatgaattga

DBGET integrated database retrieval system