KEGG   Listeria monocytogenes EGD-e (serotype 1/2a): lmo1414Help
Entry
lmo1414           CDS       T00066                                 

Definition
(RefSeq) acetyl-CoA:acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
lmo  Listeria monocytogenes EGD-e (serotype 1/2a)
Pathway
lmo00071  Fatty acid degradation
lmo00072  Synthesis and degradation of ketone bodies
lmo00280  Valine, leucine and isoleucine degradation
lmo00310  Lysine degradation
lmo00362  Benzoate degradation
lmo00380  Tryptophan metabolism
lmo00620  Pyruvate metabolism
lmo00630  Glyoxylate and dicarboxylate metabolism
lmo00640  Propanoate metabolism
lmo00650  Butanoate metabolism
lmo00900  Terpenoid backbone biosynthesis
lmo01100  Metabolic pathways
lmo01110  Biosynthesis of secondary metabolites
lmo01120  Microbial metabolism in diverse environments
lmo01130  Biosynthesis of antibiotics
lmo01200  Carbon metabolism
lmo01212  Fatty acid metabolism
lmo02020  Two-component system
Brite
KEGG Orthology (KO) [BR:lmo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    lmo1414
   00630 Glyoxylate and dicarboxylate metabolism
    lmo1414
   00640 Propanoate metabolism
    lmo1414
   00650 Butanoate metabolism
    lmo1414
  09103 Lipid metabolism
   00071 Fatty acid degradation
    lmo1414
   00072 Synthesis and degradation of ketone bodies
    lmo1414
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    lmo1414
   00310 Lysine degradation
    lmo1414
   00380 Tryptophan metabolism
    lmo1414
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    lmo1414
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    lmo1414
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    lmo1414
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lmo04147]
    lmo1414
Enzymes [BR:lmo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     lmo1414
Exosome [BR:lmo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   lmo1414
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-GeneID: 986819
NCBI-ProteinID: NP_464939
Pasteur: LMO01414
UniProt: Q8Y782
Position
complement(1443873..1445042)
Genome map
AA seq 389 aa AA seqDB search
MKEVVIIDAVRTPIGKFGGSLKDISAVDLGATALKGVLERANIAPERVDQVIFGNVLQAG
LGQNVARQIAIKAGIPYKVPGVTINEVCGSGLKSVMLGRQAIQLGEADIVAVGGTENMSQ
APLLLNPELAGEEINPKKLRNSMLIDGLTDVYGEYHMGITAENVAEKFSVTREEQDEFAH
NSQMKAASAQEKKLFEEEIIPVKLPDGSFFEADETIRANSTLEKLATLKSVFKEGGTVTA
GNASGINDGASAIILMSKEKAVAENIPYIATIKVTSEVGVDPALMGYAPYYAVNEALTKG
GYSIDEIDLFHLNEAFASQSVAVARDLKIPEEKLNIYGGAIALGHPIGASGARIIASLLN
ELKHENKHIGVASLCVGGGIGIAIILERA
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaagtagttataatagatgcagttagaacaccaattggaaaattcggtggtagt
ttgaaagacatcagtgcagtagatcttggtgctaccgctctaaaaggtgttttagaaaga
gccaatattgctccagaacgtgtggatcaagtaatttttggtaatgtattacaagctgga
cttggccaaaatgtagctagacaaatcgctattaaagcaggaattccttataaagtaccc
ggagtcacaatcaatgaagtgtgtggatctggcttaaaatcggttatgcttggcagacaa
gcaattcaactaggggaagctgacatcgtagcagtaggagggaccgaaaatatgtcccaa
gcaccacttttacttaatcccgagctagccggtgaagaaatcaatccaaaaaaactaaga
aatagcatgttaattgatggtttaacagatgtttacggcgaatatcacatgggaattact
gcagaaaatgttgcggaaaaattctccgtaacccgagaagaacaagatgaatttgctcat
aactctcaaatgaaggccgcaagtgcacaagaaaaaaaactttttgaagaagaaattatt
cctgtaaaacttccagacggttcattttttgaagccgatgaaacgattcgcgcgaattca
actctagaaaaattagctacgttgaaaagcgtattcaaagaaggtggaactgttacagcc
ggtaatgcttccggtatcaatgatggagcttccgcaattattttaatgtcgaaagaaaag
gcagtcgcggaaaacattccttatatcgcaacaatcaaagtaacctctgaggttggtgtc
gatccagcacttatgggttacgcgccatactatgcagtaaatgaagctttaactaaaggt
ggatattctatcgatgaaattgatttattccatttaaacgaagcttttgcatcgcagtct
gttgcagtggctcgtgatttgaaaattcccgaagagaaacttaatatttacggtggagca
attgcgctaggtcatccaatcggagcttccggcgcacgcattattgcctctttgttaaat
gaattaaaacatgaaaacaagcatatcggggtagcttccttgtgcgttggtggtggtatt
ggcattgcaattatccttgaaagagcatga

DBGET integrated database retrieval system