KEGG   Listeria monocytogenes EGD-e (serotype 1/2a): lmo1527
Entry
lmo1527           CDS       T00066                                 

Definition
(RefSeq) preprotein translocase SecDF
  KO
K12257  SecD/SecF fusion protein
Organism
lmo  Listeria monocytogenes EGD-e (serotype 1/2a)
Pathway
lmo02024  Quorum sensing
lmo03060  Protein export
lmo03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:lmo00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    lmo1527
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    lmo1527
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    lmo1527
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:lmo02044]
    lmo1527
Secretion system [BR:lmo02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   lmo1527
SSDB
Motif
Pfam: SecD_SecF Sec_GG MMPL
Other DBs
NCBI-GeneID: 987793
NCBI-ProteinID: NP_465052
Pasteur: LMO01527
UniProt: Q8Y703
Position
complement(1561978..1564242)
AA seq 754 aa
MVKKSKIVIFFLVVAIIFGAVFGTAKMVMQNINLGLDLQGGFEVLYEVSPADGKGTVSKQ
TLTDTVTSLDKRVNSLGVAEPSIQIEGNNRIRVQLAGVTDQAEARKMLSTTAQLSFRDAN
DKMMMNGSDLVAGGAKQAFDSSNNPIVTLKLKSADKFASVTKTILAEAPDNQLVIWLDWK
EGQKYKTEREKKDPAYLSAPNVSSVLDTDKVEISGSFTTEEAKDLAELLNSGALPVKMKE
VYSTSVGAQFGQDALQETILAGIIGVIAIFIFMMAVYRLPGVIASITLVAYTYLVLLILS
LLNATLTLPGIAGLILGIGMAVDANVITYERIKEEIKVGRSTKAAFEVGGKEAFRAILDG
NLTTLIVAAVLFYFGTSSIKGFATVLIISILVSFLTAVWGSRFLLGLLVKSNWLNNKPGF
FAVKRKDIHNLHEGINSFSLKTHFDRFDFVKHHRLFLSIFAAIVIVGIVILSIFRLNLGI
DFASGTRAEVTANQTLTETQIKKDLDTIDMPSDDIVFQGSGSKTAVVSYKGTLSQNDVAK
FKNYFEDKYKHEPSISTVSPTVGKELAKNGFWALGVASVLIVLYIAVRFEFYMGIAAILS
LLFDAFIIFIFFSVTRLEVDLTFIAAVLTVIGYSINDTIVTADRIRDISMKMQRFKTKEE
IADAVNKALRQTFTRSINTILTVIFTVLALVLFGSESILNFSIALLVGLVSSVFSSIFMA
MQLWYVFKARQLRKKGPISTVKKKKPRNNGQPVV
NT seq 2265 nt   +upstreamnt  +downstreamnt
atggtaaaaaagagtaagatagttattttctttctagtagttgcaattatctttggtgct
gtatttggtaccgcaaaaatggttatgcaaaacatcaacttaggcttggatcttcaaggg
ggattcgaagttctatatgaagtgtcaccagctgacggcaaagggactgtgtcgaaacaa
acgttgacagatacagtaacttcactcgataagcgtgttaattcattaggtgtagctgaa
ccaagtattcaaatcgaaggaaataaccgtatccgtgttcaacttgctggagtaactgac
caagcagaagcacgtaaaatgctatcgaccacagcccaattatcatttagagatgcaaat
gacaaaatgatgatgaatggtagtgacttggttgcaggcggtgctaaacaagcttttgat
tcaagcaataatccaatcgttacattaaaactaaaaagcgcagacaaatttgctagtgta
acaaaaacaatactagcagaagcgcctgacaatcaattagttatttggttagattggaaa
gaaggacaaaagtacaaaacagaacgcgaaaagaaagacccggcttacttatcagcacca
aacgtaagtagcgtattagatacagataaagtagagatttccggaagcttcacaacggaa
gaagcaaaagatttagctgaattgctaaactctggggcacttcctgtgaaaatgaaagag
gtttactctacatctgttggcgctcaatttggtcaagatgcattacaagaaactatttta
gctggtattattggggttattgctatctttattttcatgatggctgtttaccgtttacca
ggtgttattgcttctatcactttagttgcatacacttatttagtactattaatactgagt
ctacttaacgcaacacttactttgccagggattgcaggtttgattctggggataggtatg
gctgttgacgcgaacgtaataacctacgagcgaataaaagaagaaatcaaggttggtagg
tcgacgaaagctgcttttgaagtcggcggtaaagaagcattccgtgcgattttagatggt
aatttgacgacacttatcgtagctgcggttctcttctactttggaacaagctccatcaaa
ggttttgctacagtactaatcattagtattttagttagcttcttgacagccgtttgggga
tcaagattcttattaggcttattagtgaaaagtaattggcttaacaataaaccaggattc
tttgcagttaaacgaaaagatatccataatttacatgagggcattaatagctttagctta
aaaacacactttgaccgatttgattttgtaaaacatcatcgtctgttcttatctattttt
gctgcaattgttattgtcggtattgttattctatccatatttagactaaatctaggtatt
gactttgccagtgggacacgagcggaagtgacagctaatcaaacactgacagaaacgcaa
attaagaaagatttagatacgattgatatgccatcagatgatattgttttccaaggatca
ggttctaaaacagccgttgtttcttataaaggtacattatcgcaaaatgacgtagctaaa
tttaaaaattactttgaggacaaatataagcacgaaccaagcattagtactgtttcacca
actgtcgggaaagaacttgccaaaaatggcttctgggcactcggtgtggcgtctgtgttg
attgtactttatattgcggtccggtttgaattttatatgggtattgcagcgattctttcc
ttactattcgacgcatttatcatcttcatattcttcagtgtaacaaggctggaggttgac
ttaaccttcattgccgcggtgctgacggttatcggttattccattaatgacacgatagtc
accgccgaccggatacgagatattagtatgaagatgcaacgtttcaaaacgaaagaagaa
attgcggatgctgttaataaagcattacgacaaacattcactcgttctattaacaccatt
ttaacggttattttcaccgtacttgcacttgtactatttggtagtgagtctattctgaac
ttctccatcgccttacttgttggactggtttccagtgtattctcctccatctttatggcg
atgcaattatggtacgtatttaaagcaagacaacttcgtaaaaaaggaccaattagcaca
gttaaaaagaaaaaaccacgtaataacggacaacctgtcgtataa

DBGET integrated database retrieval system