KEGG   Listeria monocytogenes EGD-e (serotype 1/2a): lmo1576Help
Entry
lmo1576           CDS       T00066                                 

Definition
(RefSeq) hypothetical protein
Organism
lmo  Listeria monocytogenes EGD-e (serotype 1/2a)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DRTGG CBS GntR 4HBT HTH_11 HTH_23 Hpr_kinase_N HTH_29 PucR HTH_24 HTH_38 HTH_28 HTH_22 TrmB HTH_36
Motif
Other DBs
NCBI-GeneID: 986987
NCBI-ProteinID: NP_465101
Pasteur: LMO01576
UniProt: Q8Y6V5
Position
complement(1617901..1619214)
Genome map
AA seq 437 aa AA seqDB search
MATKHEQILKYIENLAVGEKISVRKIAKNLSVSEGTAYRAIKDAEIIGFVSTIKRVGTLR
IERKQKDSIEKLTFAEIVNMIDGQVLGGRAGLYKSLNKFVIGAMTVEAMERYTDAGNLLI
VGNRVSAHELALKRGAAVLITGGFDTDDEVKQLADEKELPILSTSYDTFTVATMINRAIY
DQLIKKEVVFVEDILTPLETTAFLSTSDKVEDWHKMEEATGHSRFPVVNRAMRLTGMVTS
KDILEKNPSISIERVMTKNPLTVGPKMSVASVAHMMIWESIEVIPVVKDDLTLIGIVSRQ
DILKSMQMIQKQPQVGETIDDTIANQLSEKTDTGEEADYEFKVSPQMTNSLGTLSYGVFT
QVVCEVVQQKLFSMKKRNVAIENVTMYFLKPVQMDATIIIKPRILEMGRKAGKLDVELYL
EGILTGKAIVACQMMER
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
gtggccacaaaacatgaacagattttaaaatacattgaaaatcttgcagttggagaaaaa
atatctgtgcgaaaaatcgcgaaaaacttgtctgtaagtgaaggaactgcttatcgggct
attaaagatgcagaaataatagggtttgtttctactattaaacgagtgggaacgcttcga
attgaacgcaagcaaaaagatagtatcgaaaaattaacttttgctgagattgttaatatg
atcgatgggcaagtgctaggtggtcgtgctgggctttacaaatcgcttaataagtttgtt
attggagcaatgacagtggaagcgatggaacgctataccgatgcaggaaacttattgatt
gtcggaaacagagtgagcgcccatgaacttgctttgaaacgtggcgccgcggtactgatt
actggtgggtttgatacggacgacgaagtgaaacaattggcggatgagaaagaattacca
attttatcaacttcctatgatacgtttacagttgcaacgatgattaaccgcgcgatttat
gaccaattaataaaaaaagaagtagtatttgtggaggatattttaacaccactagaaaca
actgcatttttatctacgtctgataaagtggaagattggcacaaaatggaagaagcgaca
ggtcacagtcgttttcctgtagttaaccgggcgatgcgactgactgggatggtgacgagt
aaggatattctagaaaaaaatcccagtatttcgattgaacgagtaatgacgaaaaacccg
ttaactgttggaccgaagatgagtgttgcctcagtggcgcacatgatgatttgggagagt
atcgaagtaattccagtcgttaaagatgacttaactttaatcggaattgttagcaggcag
gatatcttgaaatccatgcaaatgattcaaaaacaaccgcaagtcggcgaaacgattgat
gataccattgcgaaccaactttctgaaaaaacagatactggtgaagaggcggattacgaa
tttaaagttagcccgcaaatgactaattcgcttggaacattatcgtacggcgtatttaca
caagtagtttgtgaagttgtacaacaaaaactattttctatgaaaaaacggaatgtagcg
attgaaaatgtaacaatgtatttcctaaaacctgttcaaatggacgcgacaattattatt
aaaccgcgaattttggagatggggcgtaaggctggtaagttggatgtagagctttactta
gaaggaattttgaccggaaaagcaattgtcgcttgtcaaatgatggaacgttaa

DBGET integrated database retrieval system